StarFunc result for job id Q86WN1

User Input

>input (690 residues)
MQPPPRKVKPAQEVKLRFLEQLSILQTWQQREADLLEDIRSYSKQRAAIEREYGQALQKL
AGPFLKREGHRSGEMDSRGRTVFGAWRCLLDATVAGGQTRLQASDRYRDLAGGTGRSAKE
QVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSDHGIF
HSRTSLQKLSTKLSAQSAQYSQQLQAARNEYLLNLVATNAHLDHYYQEELPALLKALVSE
LSEHLRDPLTSLSHTELEAAEVILEHAHRGEQTTSQVSWEQDLKLFLQEPGVFSPTPPQQ
FQPAGTDQVCVLEWGAEGVAGKSGLEKEVQRLTSRAARDYKIQNHGHRVLQRLEQRRQQA
SEREAPSIEQRLQEVRESIRRAQVSQVKGAARLALLQGAGLDVERWLKPAMTQAQDEVEQ
ERRLSEARLSQRDLSPTAEDAELSDFEECEETGELFEEPAPQALATRALPCPAHVVFRYQ
AGREDELTITEGEWLEVIEEGDADEWVKARNQHGEVGFVPERYLNFPDLSLPESSQDSDN
PCGAEPTAFLAQALYSYTGQSAEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGRVGVFP
SLLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPAPTSVLDGPPAPVLPGDKALDFPGFL
DMMAPRLRPMRPPPPPPAKAPDPGHPDPLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PFY1	0.783	0.784	5.447E-83	688	0.907	0.910	Q6PFY1.pdb.gz	FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus OX=10090 GN=Fchsd1 PE=1 SV=1
2	AFDB:O94868	0.552	0.518	9.081E-43	740	0.396	0.369	O94868.pdb.gz	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
3	AFDB:X2JAU8	0.488	0.327	2.988E-33	1075	0.284	0.182	X2JAU8.pdb.gz	NWK_DROME Protein nervous wreck OS=Drosophila melanogaster OX=7227 GN=nwk PE=1 SV=1
4	AFDB:P38822	0.314	0.338	1.527E-18	633	0.152	0.166	P38822.pdb.gz	BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BZZ1 PE=1 SV=1
5	AFDB:Q7Z6B7	0.479	0.315	1.115E-14	1085	0.212	0.135	Q7Z6B7.pdb.gz	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
6	AFDB:A8JNK4	0.267	0.275	2.450E-14	665	0.151	0.156	A8JNK4.pdb.gz	A8JNK4_DROME Cdc42-interacting protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
7	AFDB:Q8CJ53	0.285	0.321	3.718E-14	603	0.157	0.179	Q8CJ53.pdb.gz	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
8	AFDB:P97531	0.285	0.349	4.909E-14	547	0.149	0.188	P97531.pdb.gz	CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Trip10 PE=1 SV=3
9	AFDB:M9PBP3	0.271	0.303	5.386E-14	602	0.157	0.179	M9PBP3.pdb.gz	M9PBP3_DROME Cdc42-interacting protein 4, isoform J OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
10	AFDB:Q5T0N5	0.280	0.313	1.563E-13	605	0.143	0.164	Q5T0N5.pdb.gz	FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3
11	PDB:2lqnA	0.084	0.183	5.590E-6	303	0.055	0.125	2lqnA.pdb.gz
12	PDB:2eyzA	0.103	0.189	2.579E-5	304	0.043	0.099	2eyzA.pdb.gz
13	PDB:6ikoA	0.270	0.532	6.218E-5	303	0.057	0.129	6ikoA.pdb.gz
14	PDB:1griA	0.091	0.288	1.084E-4	211	0.054	0.175	1griA.pdb.gz
15	PDB:3hajA	0.192	0.367	2.275E-4	286	0.058	0.140	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
16	PDB:2dybA	0.084	0.191	1.830E-3	298	0.043	0.101	2dybA.pdb.gz
17	PDB:1k9aB	0.091	0.141	2.417E-3	441	0.033	0.052	1k9aB.pdb.gz
18	PDB:3qwyA	0.083	0.324	4.214E-3	170	0.030	0.124	3qwyA.pdb.gz
19	PDB:3ehqA	0.081	0.292	5.828E-3	182	0.025	0.093	3ehqA.pdb.gz
20	PDB:2h8hA	0.078	0.119	1.406E-2	445	0.020	0.031	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PFY1	0.0	1163	688	0.910	0.913	FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus OX=10090 GN=Fchsd1 PE=1 SV=1
2	O94868	4.95e-144	439	740	0.388	0.362	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
3	Q3USJ8	4.86e-143	437	740	0.390	0.364	FCSD2_MOUSE F-BAR and double SH3 domains protein 2 OS=Mus musculus OX=10090 GN=Fchsd2 PE=1 SV=2
4	X2JAU8	5.68e-37	151	1075	0.155	0.100	NWK_DROME Protein nervous wreck OS=Drosophila melanogaster OX=7227 GN=nwk PE=1 SV=1
5	Q7Z6B7	3.45e-14	79.0	1085	0.120	0.076	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
6	Q91Z69	6.17e-14	78.2	1062	0.119	0.077	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
7	Q812A2	1.26e-11	70.5	1099	0.116	0.073	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
8	O43295	1.33e-11	70.5	1099	0.116	0.073	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
9	A9P3U3	8.20e-11	67.8	774	0.091	0.081	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
10	F8W7U0	1.24e-09	64.3	1149	0.058	0.035	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
11	B7ZM87	1.35e-09	63.9	1070	0.128	0.082	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
12	Q9WVE9	2.01e-09	63.5	1713	0.052	0.021	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
13	O75044	2.03e-09	63.5	1071	0.133	0.086	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
14	Q15811	2.64e-09	63.2	1721	0.059	0.024	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
15	Q9Z0R4	2.66e-09	63.2	1714	0.052	0.021	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
16	Q09746	3.30e-09	62.4	642	0.087	0.093	BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bzz1 PE=3 SV=1
17	A0A0S2Z4Y3	4.10e-09	61.2	377	0.075	0.138	A0A0S2Z4Y3_HUMAN NCK adaptor protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=2 SV=1
18	P16333	4.10e-09	61.2	377	0.075	0.138	NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
19	D4A208	4.31e-09	62.4	1071	0.119	0.077	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
20	Q91Z67	4.42e-09	62.4	1071	0.132	0.085	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	1.7e-11	55.7	Fes/CIP4, and EFC/F-BAR homology domain
2	PF14603 hSH3	5.7	18.9	Helically-extended SH3 domain
3	PF00018 SH3_1	2.4e-14	64.0	SH3 domain
4	PF07653 SH3_2	4.3e-13	60.2	Variant SH3 domain
5	PF08239 SH3_3	18	17.1	Bacterial SH3 domain
6	PF14604 SH3_9	4e-19	79.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223023	0.816	Neural Wiskott-Aldrich syndrome protein
2	9606.ENSP00000365891	0.787	Wiskott-Aldrich syndrome protein
3	9606.ENSP00000376024	0.763	Sorting nexin-9
4	9606.ENSP00000273859	0.739	Probable phospholipid-transporting ATPase VD
5	9606.ENSP00000379621	0.739	Sorting nexin-16
6	9606.ENSP00000413625	0.714	Formin-binding protein 1
7	9606.ENSP00000320117	0.712	Cdc42-interacting protein 4
8	9606.ENSP00000347244	0.709	Intersectin-2
9	9606.ENSP00000311427	0.698	Sorting nexin-33
10	9606.ENSP00000248114	0.678	FAD-linked sulfhydryl oxidase ALR
11	9606.ENSP00000317332	0.671	Sorting nexin-18
12	9606.ENSP00000473001	0.670	F-BAR domain only protein 1
13	9606.ENSP00000363339	0.659	UBX domain-containing protein 11
14	9606.ENSP00000373905	0.626	Dynamin-2
15	9606.ENSP00000359045	0.607	Rho GTPase-activating protein 4
16	9606.ENSP00000394051	0.604	Nostrin
17	9606.ENSP00000465099	0.595	DNA-directed RNA polymerase I subunit RPA34
18	9606.ENSP00000383118	0.575	Cell division control protein 42 homolog
19	9606.ENSP00000452746	0.575	Proline-serine-threonine phosphatase-interacting protein 1
20	9606.ENSP00000362014	0.571	Dynamin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008289	0.970	lipid binding
GO:0005543	0.958	phospholipid binding
GO:0043168	0.484	anion binding
GO:0043325	0.467	phosphatidylinositol-3,4-bisphosphate binding
GO:0042802	0.310	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.988	biological regulation
GO:0050794	0.976	regulation of cellular process
GO:0048522	0.961	positive regulation of cellular process
GO:0016043	0.927	cellular component organization
GO:1902905	0.915	positive regulation of supramolecular fiber organization
GO:0061024	0.909	membrane organization
GO:0051495	0.907	positive regulation of cytoskeleton organization
GO:0044089	0.878	positive regulation of cellular component biogenesis
GO:0030838	0.867	positive regulation of actin filament polymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.971	cytosol
GO:0016020	0.968	membrane
GO:0005856	0.966	cytoskeleton
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005886	0.943	plasma membrane
GO:0015629	0.874	actin cytoskeleton
GO:0030863	0.720	cortical cytoskeleton
GO:0031982	0.719	vesicle
GO:0031974	0.665	membrane-enclosed lumen
GO:0043233	0.462	organelle lumen
GO:0070013	0.432	intracellular organelle lumen
GO:0005654	0.402	nucleoplasm
GO:0032437	0.385	cuticular plate

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]