StarFunc result for job id Q86WR6

User Input

>input (236 residues)
MEASDGQGGEGDKPLEQVTNVSCLETSSSASPARDSLMRHAKGLDQDTFKTCKEYLRPLK
KFLRKLHLPRDLPQKKKLKYMKQSLVVLGDHINTFLQHYCQAWEIKHWRKMLWRFISLFS
ELEAKQLRRLYKYTKSSQPAKFLVTFCASDAPERSLLADREDSLPKLCHAWGLHSNISGM
KERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IR86	0.388	0.053	2.602E-6	1799	0.208	0.027	A0A0R4IR86.pdb.gz	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
2	AFDB:P40201	0.380	0.055	5.577E-6	1711	0.246	0.034	P40201.pdb.gz	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
3	AFDB:O14647	0.386	0.053	7.190E-6	1828	0.212	0.027	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
4	AFDB:Q7KU24	0.382	0.052	2.561E-5	1883	0.220	0.028	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
5	AFDB:Q54Q16	0.350	0.047	1.765E-4	1917	0.161	0.020	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
6	AFDB:F4IV99	0.361	0.057	9.933E-4	1724	0.182	0.025	F4IV99.pdb.gz	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
7	AFDB:O14139	0.370	0.065	7.976E-3	1388	0.106	0.018	O14139.pdb.gz	HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp3 PE=1 SV=1
8	AFDB:Q8C0D7	0.140	0.135	2.795E-1	249	0.089	0.084	Q8C0D7.pdb.gz	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
9	AFDB:A0A1D5P266	0.140	0.062	3.255E-1	682	0.148	0.051	A0A1D5P266.pdb.gz
10	AFDB:Q8WYH8	0.150	0.148	3.425E-1	240	0.114	0.113	Q8WYH8.pdb.gz	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
11	PDB:1yviA	0.203	0.281	8.449E-1	140	0.068	0.114	1yviA.pdb.gz
12	PDB:4eukB	0.169	0.238	1.089	152	0.072	0.112	4eukB.pdb.gz	Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
13	PDB:1keyB	0.206	0.217	1.269	221	0.076	0.081	1keyB.pdb.gz
14	PDB:1wn0C	0.180	0.270	1.811	138	0.064	0.109	1wn0C.pdb.gz
15	PDB:5n9jE	0.148	0.168	2.219	201	0.068	0.080	5n9jE.pdb.gz
16	PDB:6eznB	0.184	0.347	2.456	110	0.093	0.200	6eznB.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
17	PDB:3duhC	0.161	0.240	3.009	137	0.076	0.131	3duhC.pdb.gz
18	PDB:7n9sA	0.119	0.021	3.009	2365	0.093	0.009	7n9sA.pdb.gz
19	PDB:4pacA	0.168	0.240	3.166	153	0.064	0.098	4pacA.pdb.gz
20	PDB:7o4i1	0.162	0.085	3.166	522	0.093	0.042	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40201	2.26e-19	89.0	1711	0.186	0.026	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
2	O14646	1.11e-18	87.0	1710	0.169	0.023	CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1 PE=1 SV=2
3	A0A0R4IR86	2.71e-15	77.0	1799	0.165	0.022	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
4	E9PZM4	2.41e-13	71.2	1827	0.148	0.019	CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Chd2 PE=1 SV=1
5	O14647	3.02e-13	70.9	1828	0.148	0.019	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
6	Q7KU24	1.29e-12	68.9	1883	0.153	0.019	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
7	F4IV99	0.059	37.0	1724	0.089	0.012	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
8	Q54Q16	0.066	37.0	1917	0.110	0.014	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
9	A0A0B4K621	1.2	32.7	860	0.076	0.021	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
10	A0A0B4K653	1.2	32.7	919	0.076	0.020	A0A0B4K653_DROME Rfx, isoform H OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
11	A0A0B4K6P1	1.2	32.7	911	0.076	0.020	A0A0B4K6P1_DROME Rfx, isoform C OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
12	A0A0B4KFL4	1.2	32.7	882	0.076	0.020	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
13	A8JQX0	1.2	32.7	889	0.076	0.020	A8JQX0_DROME Rfx, isoform I OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
14	Q9U1K2	1.2	32.7	897	0.076	0.020	Q9U1K2_DROME RFX transcription factor OS=Drosophila melanogaster OX=7227 GN=Rfx PE=2 SV=1
15	Q9VGZ6	1.2	32.7	897	0.076	0.020	Q9VGZ6_DROME Rfx, isoform J OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
16	O13559	1.4	32.7	1382	0.064	0.011	YRF14_YEAST Y' element ATP-dependent helicase protein 1 copy 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-4 PE=2 SV=1
17	P40105	1.7	32.3	1681	0.064	0.009	YRF12_YEAST Y' element ATP-dependent helicase protein 1 copy 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-2 PE=2 SV=2
18	P0CX20	1.8	32.3	1796	0.064	0.008	YRF11_YEAST Y' element ATP-dependent helicase protein 1 copy 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-1 PE=2 SV=1
19	P0CX21	1.8	32.3	1796	0.064	0.008	YRF15_YEAST Y' element ATP-dependent helicase protein 1 copy 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-5 PE=2 SV=1
20	P0CX14	1.9	32.3	1859	0.064	0.008	YRF13_YEAST Y' element ATP-dependent helicase protein 1 copy 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13907 DUF4208	7.9e-15	66.4	Domain of unknown function (DUF4208)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307208	0.798	Nucleosome-remodeling factor subunit BPTF
2	9606.ENSP00000304670	0.749	E3 ubiquitin-protein ligase RNFT1
3	9606.ENSP00000216297	0.702	FACT complex subunit SPT16
4	9606.ENSP00000278412	0.672	FACT complex subunit SSRP1
5	9606.ENSP00000365486	0.653	Beta-defensin 123
6	9606.ENSP00000251241	0.644	Probable ATP-dependent RNA helicase DHX40
7	9606.ENSP00000184956	0.627	HEAT repeat-containing protein 6
8	9606.ENSP00000410111	0.627	TBC1 domain family member 26
9	9606.ENSP00000312272	0.622	Protein yippee-like 2
10	9606.ENSP00000319104	0.620	Transcription elongation factor SPT6
11	9606.ENSP00000339973	0.618	TBC1 domain family member 28
12	9606.ENSP00000382000	0.612	CMT1A duplicated region transcript 15 like 2
13	9606.ENSP00000437812	0.610	Protein FAM106A
14	9606.ENSP00000329522	0.593	Speedy protein E4
15	9606.ENSP00000414237	0.583	Integrator complex subunit 2
16	9606.ENSP00000353717	0.582	Coiled-coil domain containing 144A
17	9606.ENSP00000320797	0.577	Tubulin delta chain
18	9606.ENSP00000456861	0.575	TBC1 domain family member 3G
19	9606.ENSP00000379242	0.572	CMT1A duplicated region transcript 1 protein
20	9606.ENSP00000297307	0.559	Solute carrier family 35 member G3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003676	0.998	nucleic acid binding
GO:0003677	0.525	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0050789	0.969	regulation of biological process
GO:0050794	0.908	regulation of cellular process
GO:0019222	0.877	regulation of metabolic process
GO:0060255	0.820	regulation of macromolecule metabolic process
GO:0080090	0.791	regulation of primary metabolic process
GO:0051171	0.771	regulation of nitrogen compound metabolic process
GO:0031323	0.736	regulation of cellular metabolic process
GO:0071704	0.712	organic substance metabolic process
GO:0044238	0.696	primary metabolic process
GO:0006807	0.652	nitrogen compound metabolic process
GO:0043170	0.628	macromolecule metabolic process
GO:0019219	0.614	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.611	positive regulation of biological process
GO:0010468	0.527	regulation of gene expression
GO:0044237	0.507	cellular metabolic process
GO:0048522	0.433	positive regulation of cellular process
GO:0016043	0.378	cellular component organization
GO:0009893	0.346	positive regulation of metabolic process
GO:0051252	0.342	regulation of RNA metabolic process
GO:0010604	0.341	positive regulation of macromolecule metabolic process
GO:0031326	0.332	regulation of cellular biosynthetic process
GO:0006325	0.317	chromatin organization
GO:0048519	0.311	negative regulation of biological process
GO:0010556	0.305	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0032991	0.446	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]