StarFunc result for job id Q86WU2

User Input

>input (507 residues)
MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESV
HRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMD
RILELNQEDFSVVVEPGVTRKALNAHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRY
GTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYN
LTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE
FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEA
EERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVG
HVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV
GAVGVETMRQLKAVLDPQGLMNPGKVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WU2	1.000	1.000	0.000	507	1.000	1.000	Q86WU2.pdb.gz	LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=LDHD PE=1 SV=1
2	AFDB:A0A0G2K1W9	0.908	0.955	6.809E-89	482	0.815	0.857	A0A0G2K1W9.pdb.gz	A0A0G2K1W9_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=3 SV=2
3	AFDB:F1QXM5	0.900	0.918	5.175E-77	497	0.619	0.632	F1QXM5.pdb.gz	LDHD_DANRE Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
4	AFDB:Q7TPJ4	0.826	0.835	2.393E-73	501	0.722	0.731	Q7TPJ4.pdb.gz	Q7TPJ4_RAT Ac2-202 OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1
5	AFDB:Q94AX4	0.888	0.794	1.596E-59	567	0.393	0.351	Q94AX4.pdb.gz	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
6	AFDB:P32891	0.868	0.752	2.528E-50	587	0.341	0.295	P32891.pdb.gz	DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
7	AFDB:Q11061	0.852	0.947	3.009E-44	455	0.290	0.323	Q11061.pdb.gz	Q11061_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1257c PE=1 SV=1
8	AFDB:P9WIT1	0.837	0.921	9.885E-44	459	0.268	0.296	P9WIT1.pdb.gz	Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2280 PE=1 SV=1
9	AFDB:P0AEP9	0.852	0.865	3.436E-43	499	0.264	0.269	P0AEP9.pdb.gz	GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) OX=83333 GN=glcD PE=1 SV=1
10	AFDB:O29853	0.807	0.920	8.196E-42	443	0.278	0.318	O29853.pdb.gz	DLD_ARCFU D-lactate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=dld PE=1 SV=1
11	PDB:6lpnB	0.822	0.888	1.738E-38	467	0.250	0.272	6lpnB.pdb.gz	Structure, substrate specificity, and catalytic mechanism of human D-2-HGDH and insights into pathogenicity of disease-associated mutations.
12	PDB:5adzC	0.787	0.721	1.716E-30	557	0.207	0.189	5adzC.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
13	PDB:5adzA	0.770	0.694	2.551E-30	566	0.211	0.189	5adzA.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
14	PDB:2uuuA	0.702	0.651	1.657E-26	550	0.189	0.175	2uuuA.pdb.gz	The Crucial Step in Ether Phospholipid Biosynthesis: Structural Basis of a Noncanonical Reaction Associated with a Peroxisomal Disorder.
15	PDB:1f0xA	0.705	0.711	3.743E-22	502	0.185	0.187	1f0xA.pdb.gz	The crystal structure of D-lactate dehydrogenase, a peripheral membrane respiratory enzyme.
16	PDB:3w8wB	0.626	0.681	8.602E-20	461	0.170	0.187	3w8wB.pdb.gz	Flavin-mediated dual oxidation controls an enzymatic Favorskii-type rearrangement.
17	PDB:2exrA	0.657	0.676	2.384E-19	491	0.150	0.155	2exrA.pdb.gz	Crystal structure of Arabidopsis thaliana cytokinin dehydrogenase.
18	PDB:6hfwA	0.559	0.651	2.432E-18	429	0.142	0.168	6hfwA.pdb.gz	Novel insight into the reaction of nitro, nitroso and hydroxylamino benzothiazinones and of benzoxacinones with Mycobacterium tuberculosis DprE1.
19	PDB:4pfdB	0.566	0.686	6.369E-18	410	0.138	0.171	4pfdB.pdb.gz	Crystal structure of M. tuberculosis in complex with a cBT
20	PDB:4dnsA	0.620	0.643	7.274E-17	486	0.142	0.148	4dnsA.pdb.gz	Various cross-reactivity of the grass pollen group 4 allergens: crystallographic study of the Bermuda grass isoallergen Cyn d 4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1W9	0.0	823	484	0.819	0.857	A0A0G2K1W9_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=3 SV=2
2	A0A8I5Y6D8	0.0	718	466	0.742	0.807	A0A8I5Y6D8_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1
3	F1QXM5	0.0	662	497	0.617	0.630	LDHD_DANRE Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
4	Q7TNG8	0.0	821	484	0.815	0.853	LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1
5	Q7TPJ4	0.0	703	501	0.724	0.733	Q7TPJ4_RAT Ac2-202 OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1
6	Q86WU2	0.0	1043	507	1.000	1.000	LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=LDHD PE=1 SV=1
7	Q9D635	0.0	745	481	0.765	0.807	Q9D635_MOUSE FAD-binding PCMH-type domain-containing protein OS=Mus musculus OX=10090 GN=Ldhd PE=2 SV=1
8	Q94AX4	1.77e-127	385	567	0.385	0.344	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
9	P32891	2.52e-96	305	587	0.335	0.290	DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
10	Q9I6H4	3.65e-56	196	464	0.278	0.304	Q9I6H4_PSEAE FAD-binding PCMH-type domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0317 PE=4 SV=1
11	P0AEP9	7.00e-52	185	499	0.266	0.271	GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) OX=83333 GN=glcD PE=1 SV=1
12	P9WIT1	6.41e-51	182	459	0.280	0.309	Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2280 PE=1 SV=1
13	Q11061	1.12e-47	173	455	0.284	0.316	Q11061_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1257c PE=1 SV=1
14	O29853	1.97e-44	164	443	0.276	0.316	DLD_ARCFU D-lactate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=dld PE=1 SV=1
15	P84850	5.08e-43	162	535	0.256	0.243	D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=D2hgdh PE=1 SV=1
16	Q8N465	6.89e-40	153	521	0.252	0.246	D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=D2HGDH PE=1 SV=3
17	P46681	1.81e-39	152	530	0.245	0.234	DLD2_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD2 PE=1 SV=1
18	P39976	7.22e-35	139	496	0.233	0.238	DLD3_YEAST D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD3 PE=1 SV=1
19	O23240	3.03e-34	137	559	0.235	0.213	D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=D2HGDH PE=1 SV=3
20	Q7K511	3.86e-34	137	533	0.227	0.216	Q7K511_DROME CG3835-RA OS=Drosophila melanogaster OX=7227 GN=D2hgdh PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02913 FAD-oxidase_C	3.7e-64	228.3	FAD linked oxidases, C-terminal domain
2	PF01565 FAD_binding_4	3.8e-35	132.1	FAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379386	0.965	Lactate dehydrogenase B
2	9606.ENSP00000445175	0.964	Lactate dehydrogenase A
3	9606.ENSP00000302393	0.961	Lactate dehydrogenase A like 6B
4	9606.ENSP00000437783	0.960	L-lactate dehydrogenase C chain
5	9606.ENSP00000280706	0.944	L-lactate dehydrogenase A-like 6A
6	9606.ENSP00000339933	0.938	Pyruvate kinase PKLR
7	9606.ENSP00000320171	0.935	Pyruvate kinase PKM
8	9606.ENSP00000377532	0.932	Pyruvate carboxylase, mitochondrial
9	9606.ENSP00000307241	0.931	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
10	9606.ENSP00000380514	0.912	Hydroxyacylglutathione hydrolase, mitochondrial
11	9606.ENSP00000358719	0.911	Malic enzyme 1
12	9606.ENSP00000440246	0.908	NADP-dependent malic enzyme, mitochondrial
13	9606.ENSP00000295266	0.905	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
14	9606.ENSP00000321070	0.903	NAD-dependent malic enzyme, mitochondrial
15	9606.ENSP00000370377	0.903	Presequence protease, mitochondrial
16	9606.ENSP00000249269	0.901	Mitochondrial-processing peptidase subunit beta
17	9606.ENSP00000360782	0.901	Mitochondrial-processing peptidase subunit alpha
18	9606.ENSP00000377668	0.748	Sulfite oxidase, mitochondrial
19	9606.ENSP00000464522	0.688	Mitochondrial import inner membrane translocase subunit Tim23
20	9606.ENSP00000205402	0.678	Dihydrolipoyl dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.946	catalytic activity
GO:0016614	0.736	oxidoreductase activity, acting on CH-OH group of donors
GO:0097159	0.536	organic cyclic compound binding
GO:1901363	0.534	heterocyclic compound binding
GO:0043167	0.470	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.993	small molecule metabolic process
GO:1901575	0.981	organic substance catabolic process
GO:0072329	0.961	monocarboxylic acid catabolic process
GO:0006089	0.879	lactate metabolic process
GO:1901616	0.712	organic hydroxy compound catabolic process
GO:0044238	0.473	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.967	membrane
GO:0031090	0.910	organelle membrane
GO:0031966	0.878	mitochondrial membrane
GO:0005743	0.870	mitochondrial inner membrane
GO:0070013	0.340	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	0.736	Acting on the CH-OH group of donors.

[back to server]