StarFunc result for job id Q86WV1

User Input

>input (359 residues)
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQG
GDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKD
HSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFEL
TSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDS
PSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQ
GLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WV1	1.000	1.000	5.370E-67	359	1.000	1.000	Q86WV1.pdb.gz	SKAP1_HUMAN Src kinase-associated phosphoprotein 1 OS=Homo sapiens OX=9606 GN=SKAP1 PE=1 SV=3
2	AFDB:Q3UUV5	0.389	0.393	2.077E-53	355	0.811	0.820	Q3UUV5.pdb.gz	SKAP1_MOUSE Src kinase-associated phosphoprotein 1 OS=Mus musculus OX=10090 GN=Skap1 PE=1 SV=1
3	AFDB:O75563	0.470	0.470	5.548E-37	359	0.429	0.429	O75563.pdb.gz	SKAP2_HUMAN Src kinase-associated phosphoprotein 2 OS=Homo sapiens OX=9606 GN=SKAP2 PE=1 SV=1
4	AFDB:Q63406	0.234	0.080	4.483E-11	1149	0.184	0.057	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
5	AFDB:Q5JY90	0.234	0.179	6.364E-11	483	0.131	0.097	Q5JY90.pdb.gz	Q5JY90_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1
6	AFDB:O15068	0.231	0.080	1.076E-10	1137	0.164	0.052	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
7	AFDB:Q969H4	0.304	0.157	1.619E-10	720	0.120	0.060	Q969H4.pdb.gz	CNKR1_HUMAN Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1 PE=1 SV=1
8	AFDB:A0A0G2K134	0.230	0.131	1.717E-10	662	0.125	0.068	A0A0G2K134.pdb.gz	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
9	AFDB:Q8WXI2	0.312	0.112	3.458E-10	1034	0.117	0.041	Q8WXI2.pdb.gz	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
10	AFDB:Q90738	0.250	0.128	3.458E-10	729	0.167	0.082	Q90738.pdb.gz	AFAP1_CHICK Actin filament-associated protein 1 OS=Gallus gallus OX=9031 GN=AFAP1 PE=1 SV=2
11	PDB:6bbpA	0.248	0.175	2.012E-8	520	0.089	0.062	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
12	PDB:6u3eA	0.216	0.197	7.078E-7	397	0.097	0.088	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
13	PDB:3ljuX	0.240	0.232	1.909E-6	373	0.061	0.059	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:6hhgA	0.238	0.222	2.967E-5	386	0.053	0.049	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	PDB:6s9wA	0.233	0.205	5.638E-5	411	0.053	0.046	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
16	PDB:4mk0A	0.244	0.142	8.484E-5	631	0.042	0.024	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:4mt6A	0.249	0.231	8.484E-5	389	0.067	0.062	4mt6A.pdb.gz
18	PDB:7rx9A	0.237	0.199	9.535E-5	432	0.045	0.037	7rx9A.pdb.gz
19	PDB:4iapA	0.187	0.258	1.521E-4	256	0.047	0.066	4iapA.pdb.gz
20	PDB:3uzsA	0.221	0.138	1.812E-4	609	0.086	0.051	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UUV5	0.0	547	355	0.805	0.814	SKAP1_MOUSE Src kinase-associated phosphoprotein 1 OS=Mus musculus OX=10090 GN=Skap1 PE=1 SV=1
2	Q4V7G1	0.0	557	354	0.799	0.811	SKAP1_RAT Src kinase-associated phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Skap1 PE=1 SV=1
3	Q86WV1	0.0	737	359	1.000	1.000	SKAP1_HUMAN Src kinase-associated phosphoprotein 1 OS=Homo sapiens OX=9606 GN=SKAP1 PE=1 SV=3
4	Q3UND0	1.25e-92	283	358	0.451	0.453	SKAP2_MOUSE Src kinase-associated phosphoprotein 2 OS=Mus musculus OX=10090 GN=Skap2 PE=1 SV=2
5	O75563	8.42e-90	275	359	0.435	0.435	SKAP2_HUMAN Src kinase-associated phosphoprotein 2 OS=Homo sapiens OX=9606 GN=SKAP2 PE=1 SV=1
6	C9JQ17	2.06e-16	77.0	126	0.134	0.381	C9JQ17_HUMAN Src kinase associated phosphoprotein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SKAP2 PE=1 SV=1
7	A4FU49	3.85e-07	54.3	640	0.058	0.033	SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens OX=9606 GN=SH3D21 PE=2 SV=2
8	Q55CW4	1.11e-06	52.4	364	0.056	0.055	Q55CW4_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269874 PE=4 SV=1
9	Q80VL0	2.46e-06	51.2	406	0.097	0.086	ICEF1_RAT Interactor protein for cytohesin exchange factors 1 OS=Rattus norvegicus OX=10116 GN=Ipcef1 PE=1 SV=1
10	Q9Y5K6	3.49e-06	51.2	639	0.089	0.050	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
11	P34512	5.15e-06	50.4	393	0.092	0.084	GRP1_CAEEL GTP exchange factor for ARFs 1 OS=Caenorhabditis elegans OX=6239 GN=grp-1 PE=3 SV=2
12	Q969H4	5.31e-06	50.8	720	0.153	0.076	CNKR1_HUMAN Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1 PE=1 SV=1
13	P38753	6.37e-06	50.1	452	0.061	0.049	HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSE1 PE=1 SV=1
14	P32793	7.69e-06	50.1	468	0.056	0.043	YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSC84 PE=1 SV=2
15	Q96HL8	8.90e-06	49.3	342	0.058	0.061	SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens OX=9606 GN=SH3YL1 PE=1 SV=1
16	Q9JLQ0	1.14e-05	49.7	637	0.061	0.035	CD2AP_MOUSE CD2-associated protein OS=Mus musculus OX=10090 GN=Cd2ap PE=1 SV=3
17	O08641	1.67e-05	48.5	340	0.058	0.062	SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus OX=10090 GN=Sh3yl1 PE=1 SV=1
18	F1LRS8	2.35e-05	48.5	637	0.058	0.033	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
19	Q80ZE7	2.48e-05	48.5	637	0.058	0.033	Q80ZE7_RAT CD2AP/CMS OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=2 SV=1
20	A0A0G2JUN9	3.79e-05	48.1	1078	0.058	0.019	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	7.4e-16	69.9	PH domain
2	PF15413 PH_11	7.3	18.5	Pleckstrin homology domain
3	PF08458 PH_2	3.3e+02	13.0	Plant pleckstrin homology-like region
4	PF20399 PH_20	69	15.0	PH domain
5	PF15410 PH_9	0.0028	29.3	Pleckstrin homology domain
6	PF00018 SH3_1	4.9e-06	37.4	SH3 domain
7	PF07653 SH3_2	8.7e-05	33.6	Variant SH3 domain
8	PF14604 SH3_9	2.5e-05	35.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427114	0.998	FYN-binding protein 1
2	9606.ENSP00000365411	0.989	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
3	9606.ENSP00000346671	0.986	Tyrosine-protein kinase Fyn
4	9606.ENSP00000046794	0.975	Lymphocyte cytosolic protein 2
5	9606.ENSP00000376345	0.975	Growth factor receptor-bound protein 2
6	9606.ENSP00000462099	0.965	Ras association domain-containing protein 5
7	9606.ENSP00000310244	0.940	RAS guanyl-releasing protein 1
8	9606.ENSP00000358723	0.862	Ras-related protein Rap-1A
9	9606.ENSP00000337825	0.859	Tyrosine-protein kinase Lck
10	9606.ENSP00000362187	0.848	Protein FAM102A
11	9606.ENSP00000250559	0.828	Ras-related protein Rap-1b
12	9606.ENSP00000408342	0.774	PML-RARA-regulated adapter molecule 1
13	9606.ENSP00000264972	0.728	Tyrosine-protein kinase ZAP-70
14	9606.ENSP00000438886	0.708	CDK5 regulatory subunit-associated protein 3
15	9606.ENSP00000361596	0.688	Neuralized-like protein 2
16	9606.ENSP00000312942	0.684	Seizure protein 6 homolog
17	9606.ENSP00000323280	0.681	T-cell differentiation antigen CD6
18	9606.ENSP00000354782	0.653	T-cell surface glycoprotein CD3 zeta chain
19	9606.ENSP00000428924	0.640	Tyrosine-protein kinase Lyn
20	9606.ENSP00000377059	0.639	Sorting nexin-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.986	protein domain specific binding
GO:0042169	0.982	SH2 domain binding
GO:0019901	0.978	protein kinase binding
GO:0017124	0.973	SH3 domain binding
GO:0019902	0.729	phosphatase binding
GO:0019903	0.719	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.990	cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0030155	0.980	regulation of cell adhesion
GO:0045785	0.930	positive regulation of cell adhesion
GO:0051716	0.916	cellular response to stimulus
GO:0007165	0.906	signal transduction
GO:0002768	0.750	immune response-regulating cell surface receptor signaling pathway
GO:0050778	0.712	positive regulation of immune response
GO:0002429	0.681	immune response-activating cell surface receptor signaling pathway
GO:0019222	0.538	regulation of metabolic process
GO:0060255	0.531	regulation of macromolecule metabolic process
GO:0031323	0.509	regulation of cellular metabolic process
GO:0080090	0.507	regulation of primary metabolic process
GO:0009893	0.504	positive regulation of metabolic process
GO:0050851	0.502	antigen receptor-mediated signaling pathway
GO:0051171	0.493	regulation of nitrogen compound metabolic process
GO:0010604	0.387	positive regulation of macromolecule metabolic process
GO:0022407	0.371	regulation of cell-cell adhesion
GO:0033628	0.349	regulation of cell adhesion mediated by integrin
GO:1903039	0.347	positive regulation of leukocyte cell-cell adhesion
GO:0032501	0.319	multicellular organismal process
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process
GO:0031325	0.302	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0032991	0.993	protein-containing complex
GO:0005829	0.993	cytosol
GO:0031981	0.978	nuclear lumen
GO:0005654	0.970	nucleoplasm
GO:0045121	0.451	membrane raft
GO:0098590	0.448	plasma membrane region
GO:0098797	0.388	plasma membrane protein complex
GO:0043235	0.375	receptor complex
GO:0098802	0.334	plasma membrane signaling receptor complex
GO:0042101	0.324	T cell receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]