StarFunc result for job id Q86WV5

User Input

>input (123 residues)
MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
LVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERG
GSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WV5	1.000	1.000	7.546E-24	123	1.000	1.000	Q86WV5.pdb.gz	TEN1L_HUMAN CST complex subunit TEN1 OS=Homo sapiens OX=9606 GN=TEN1 PE=1 SV=2
2	PDB:8d0bC	0.966	0.981	1.452E-21	121	0.984	1.000	8d0bC.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
3	AFDB:Q9D7K2	0.918	0.706	5.612E-16	161	0.618	0.472	Q9D7K2.pdb.gz	TEN1L_MOUSE CST complex subunit TEN1 OS=Mus musculus OX=10090 GN=Ten1 PE=1 SV=1
4	AFDB:Q6NME7	0.831	0.807	3.500E-8	127	0.220	0.213	Q6NME7.pdb.gz	TEN1_ARATH CST complex subunit TEN1 OS=Arabidopsis thaliana OX=3702 GN=TEN1 PE=1 SV=1
5	AFDB:P0C5Y7	0.710	0.847	9.345E-7	102	0.195	0.235	P0C5Y7.pdb.gz	TEN1_SCHPO Protein ten1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ten1 PE=1 SV=1
6	PDB:3kf6B	0.699	0.810	9.723E-7	105	0.179	0.210	3kf6B.pdb.gz
7	AFDB:P0A8M0	0.548	0.170	8.187E-6	466	0.146	0.039	P0A8M0.pdb.gz	SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=asnS PE=1 SV=2
8	AFDB:P69490	0.487	0.395	1.309E-5	159	0.203	0.157	P69490.pdb.gz	CCME_ECOLI Cytochrome c-type biogenesis protein CcmE OS=Escherichia coli (strain K12) OX=83333 GN=ccmE PE=1 SV=1
9	AFDB:Q96I59	0.586	0.179	1.472E-5	477	0.146	0.038	Q96I59.pdb.gz	SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3
10	AFDB:Q38CB4	0.571	0.152	1.755E-5	541	0.098	0.022	Q38CB4.pdb.gz	Q38CB4_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6800 PE=3 SV=1
11	AFDB:Q8BGV0	0.578	0.176	3.548E-5	477	0.130	0.034	Q8BGV0.pdb.gz	SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Nars2 PE=1 SV=1
12	PDB:7uy7B	0.584	0.288	5.901E-5	291	0.122	0.052	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
13	PDB:4dayB	0.641	0.691	8.391E-5	113	0.146	0.159	4dayB.pdb.gz	Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
14	AFDB:Q0E7J7	0.478	0.221	8.552E-5	325	0.089	0.034	Q0E7J7.pdb.gz	STN1_SCHPO Protein stn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stn1 PE=1 SV=1
15	PDB:1nnxA	0.538	0.686	1.600E-4	93	0.089	0.118	1nnxA.pdb.gz
16	PDB:6i52A	0.570	0.573	2.557E-4	122	0.122	0.123	6i52A.pdb.gz	A structural and dynamic model for the assembly of Replication Protein A on single-stranded DNA.
17	PDB:3mxnB	0.602	0.570	2.712E-4	131	0.171	0.160	3mxnB.pdb.gz
18	PDB:6w6wC	0.576	0.248	3.234E-4	323	0.122	0.046	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
19	PDB:2pi2F	0.600	0.617	3.856E-4	119	0.114	0.118	2pi2F.pdb.gz
20	PDB:1eqrA	0.525	0.133	4.336E-4	590	0.089	0.019	1eqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86WV5	2.42e-88	253	123	1.000	1.000	TEN1L_HUMAN CST complex subunit TEN1 OS=Homo sapiens OX=9606 GN=TEN1 PE=1 SV=2
2	Q9D7K2	3.49e-48	153	161	0.618	0.472	TEN1L_MOUSE CST complex subunit TEN1 OS=Mus musculus OX=10090 GN=Ten1 PE=1 SV=1
3	Q6NME7	0.38	31.6	127	0.146	0.142	TEN1_ARATH CST complex subunit TEN1 OS=Arabidopsis thaliana OX=3702 GN=TEN1 PE=1 SV=1
4	E9Q7G0	0.63	31.6	2094	0.244	0.014	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
5	Q4WMJ7	0.67	31.6	2135	0.138	0.008	GLIP_ASPFU Nonribosomal peptide synthetase gliP OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gliP PE=1 SV=1
6	O75586	0.94	30.8	246	0.106	0.053	MED6_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=2
7	A0A087WYL7	0.99	30.8	257	0.106	0.051	A0A087WYL7_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=1
8	G3V4A5	0.99	30.8	249	0.106	0.052	G3V4A5_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=1
9	Q921D4	1.1	30.8	246	0.106	0.053	MED6_MOUSE Mediator of RNA polymerase II transcription subunit 6 OS=Mus musculus OX=10090 GN=Med6 PE=1 SV=2
10	A0A8I6GLU7	1.2	30.4	242	0.106	0.054	A0A8I6GLU7_RAT Mediator of RNA polymerase II transcription subunit 6 OS=Rattus norvegicus OX=10116 GN=Med6 PE=3 SV=1
11	A0A8I6AVM6	1.4	30.0	196	0.106	0.066	A0A8I6AVM6_RAT Mediator of RNA polymerase II transcription subunit 6 OS=Rattus norvegicus OX=10116 GN=Med6 PE=3 SV=1
12	Q8L7Z9	3.5	29.3	564	0.146	0.032	DIT2_SPIOL Dicarboxylate transporter 2, chloroplastic OS=Spinacia oleracea OX=3562 GN=DIT2 PE=1 SV=1
13	F1Q9F5	3.9	29.3	953	0.130	0.017	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
14	C8VDH4	6.9	28.1	207	0.138	0.082	C8VDH4_EMENI MutT/nudix family protein (AFU_orthologue AFUA_5G08240) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07711 PE=4 SV=1
15	O88627	8.4	28.1	660	0.114	0.021	S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus OX=10090 GN=Slc28a2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15490 Ten1_2	6.4e-42	153.4	Telomere-capping, CST complex subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000224950	0.999	CST complex subunit STN1
2	9606.ENSP00000313759	0.999	CST complex subunit CTC1
3	9606.ENSP00000350249	0.931	Protection of telomeres protein 1
4	9606.ENSP00000267415	0.925	TERF1-interacting nuclear factor 2
5	9606.ENSP00000483117	0.919	Adrenocortical dysplasia protein homolog
6	9606.ENSP00000276603	0.908	Telomeric repeat-binding factor 1
7	9606.ENSP00000369411	0.875	Replication factor C subunit 3
8	9606.ENSP00000300086	0.865	Telomeric repeat-binding factor 2-interacting protein 1
9	9606.ENSP00000309572	0.845	Telomerase reverse transcriptase
10	9606.ENSP00000254942	0.832	Telomeric repeat-binding factor 2
11	9606.ENSP00000352257	0.812	X-ray repair cross-complementing protein 6
12	9606.ENSP00000375978	0.810	X-ray repair cross-complementing protein 5
13	9606.ENSP00000223129	0.762	Replication protein A 14 kDa subunit
14	9606.ENSP00000429430	0.738	Teneurin-2
15	9606.ENSP00000226444	0.708	Estrogen sulfotransferase
16	9606.ENSP00000265465	0.704	DNA polymerase alpha subunit B
17	9606.ENSP00000272091	0.701	Replication stress response regulator SDE2
18	9606.ENSP00000055077	0.697	Replication factor C subunit 2
19	9606.ENSP00000368349	0.693	DNA polymerase alpha catalytic subunit
20	9606.ENSP00000338573	0.688	Guanine nucleotide-binding protein-like 3-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042162	1.000	telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006996	0.995	organelle organization
GO:0051276	0.994	chromosome organization
GO:0006259	0.993	DNA metabolic process
GO:2000278	0.992	regulation of DNA biosynthetic process
GO:0032204	0.991	regulation of telomere maintenance
GO:0051053	0.991	negative regulation of DNA metabolic process
GO:0051129	0.988	negative regulation of cellular component organization
GO:0031327	0.985	negative regulation of cellular biosynthetic process
GO:1904356	0.981	regulation of telomere maintenance via telomere lengthening
GO:0010639	0.980	negative regulation of organelle organization
GO:0016233	0.979	telomere capping
GO:2000279	0.978	negative regulation of DNA biosynthetic process
GO:2001251	0.973	negative regulation of chromosome organization
GO:0032210	0.973	regulation of telomere maintenance via telomerase
GO:0032205	0.395	negative regulation of telomere maintenance
GO:0032211	0.369	negative regulation of telomere maintenance via telomerase
GO:0050896	0.348	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000783	1.000	nuclear telomere cap complex
GO:0005654	0.999	nucleoplasm
GO:1990879	0.613	CST complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]