StarFunc result for job id Q86WV6

User Input

>input (379 residues)
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WV6	1.000	1.000	1.695E-62	379	1.000	1.000	Q86WV6.pdb.gz	STING_HUMAN Stimulator of interferon genes protein OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
2	AFDB:Q3TBT3	0.540	0.541	1.731E-46	378	0.686	0.688	Q3TBT3.pdb.gz	STING_MOUSE Stimulator of interferon genes protein OS=Mus musculus OX=10090 GN=Sting1 PE=1 SV=2
3	AFDB:F1M391	0.915	0.915	2.946E-46	379	0.689	0.689	F1M391.pdb.gz	STING_RAT Stimulator of interferon genes protein OS=Rattus norvegicus OX=10116 GN=Sting1 PE=1 SV=2
4	PDB:7siiA	0.470	0.545	8.272E-46	324	0.852	0.997	7siiA.pdb.gz	Activation of STING by targeting a pocket in the transmembrane domain.
5	PDB:6nt5A	0.749	0.968	3.077E-37	292	0.768	0.997	6nt5A.pdb.gz
6	AFDB:E1C7U0	0.530	0.530	5.608E-29	379	0.404	0.404	E1C7U0.pdb.gz	STING_CHICK Stimulator of interferon genes protein OS=Gallus gallus OX=9031 GN=STING1 PE=1 SV=2
7	AFDB:A8E5V9	0.579	0.662	5.001E-25	329	0.338	0.389	A8E5V9.pdb.gz	STING_XENTR Stimulator of interferon genes protein OS=Xenopus tropicalis OX=8364 GN=sting1 PE=2 SV=1
8	AFDB:E7F4N7	0.786	0.750	2.893E-24	398	0.330	0.314	E7F4N7.pdb.gz	STING_DANRE Stimulator of interferon genes protein OS=Danio rerio OX=7955 GN=sting1 PE=1 SV=1
9	AFDB:A7SLZ2	0.751	0.755	4.776E-22	377	0.269	0.271	A7SLZ2.pdb.gz	STING_NEMVE Stimulator of interferon genes protein OS=Nematostella vectensis OX=45351 GN=v1g246111 PE=1 SV=1
10	PDB:6nt7A	0.442	0.561	5.148E-22	294	0.364	0.469	6nt7A.pdb.gz	Cryo-EM structures of STING reveal its mechanism of activation by cyclic GMP-AMP.
11	PDB:6nt6A	0.679	0.915	2.597E-19	278	0.351	0.478	6nt6A.pdb.gz
12	AFDB:A0A494C0T1	0.336	0.726	4.260E-18	164	0.351	0.811	A0A494C0T1.pdb.gz	A0A494C0T1_HUMAN Stimulator of interferon response cGAMP interactor 1 OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
13	AFDB:A0A0B4LFY9	0.458	0.503	2.407E-12	343	0.182	0.201	A0A0B4LFY9.pdb.gz	STING_DROME Stimulator of interferon genes protein homolog OS=Drosophila melanogaster OX=7227 GN=Sting PE=1 SV=1
14	AFDB:P35831	0.095	0.064	7.807E-2	775	0.082	0.040	P35831.pdb.gz	PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus OX=10090 GN=Ptpn12 PE=1 SV=3
15	PDB:6ylgb	0.144	0.102	2.312E-1	613	0.066	0.041	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
16	PDB:4xb6E	0.098	0.188	7.064E-1	149	0.045	0.114	4xb6E.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
17	PDB:7of4C	0.177	0.163	7.450E-1	422	0.095	0.085	7of4C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
18	PDB:5d80G	0.111	0.157	7.857E-1	223	0.074	0.126	5d80G.pdb.gz
19	PDB:3t1tA	0.133	0.213	1.488	193	0.058	0.114	3t1tA.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
20	PDB:7lbmn	0.091	0.108	1.488	283	0.074	0.099	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0W5	0.0	530	260	0.686	1.000	A0A494C0W5_HUMAN Stimulator of interferon genes protein OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
2	F1M391	0.0	513	379	0.689	0.689	STING_RAT Stimulator of interferon genes protein OS=Rattus norvegicus OX=10116 GN=Sting1 PE=1 SV=2
3	J3QTB1	0.0	517	283	0.668	0.894	J3QTB1_HUMAN Stimulator of interferon response cGAMP interactor 1 OS=Homo sapiens OX=9606 GN=STING1 PE=3 SV=2
4	Q3TBT3	0.0	539	378	0.689	0.690	STING_MOUSE Stimulator of interferon genes protein OS=Mus musculus OX=10090 GN=Sting1 PE=1 SV=2
5	Q86WV6	0.0	773	379	1.000	1.000	STING_HUMAN Stimulator of interferon genes protein OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
6	A0A494C0T1	8.83e-92	274	164	0.354	0.817	A0A494C0T1_HUMAN Stimulator of interferon response cGAMP interactor 1 OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
7	E1C7U0	1.67e-86	268	379	0.435	0.435	STING_CHICK Stimulator of interferon genes protein OS=Gallus gallus OX=9031 GN=STING1 PE=1 SV=2
8	A8E5V9	7.82e-76	239	329	0.354	0.407	STING_XENTR Stimulator of interferon genes protein OS=Xenopus tropicalis OX=8364 GN=sting1 PE=2 SV=1
9	E7F4N7	9.41e-53	182	398	0.325	0.309	STING_DANRE Stimulator of interferon genes protein OS=Danio rerio OX=7955 GN=sting1 PE=1 SV=1
10	A7SLZ2	5.86e-35	134	377	0.264	0.265	STING_NEMVE Stimulator of interferon genes protein OS=Nematostella vectensis OX=45351 GN=v1g246111 PE=1 SV=1
11	P0DV10	1.97e-06	51.6	345	0.148	0.162	STING_DROEU Stimulator of interferon genes protein homolog OS=Drosophila eugracilis OX=29029 GN=Sting PE=1 SV=1
12	A0A0B4LFY9	4.45e-04	44.3	343	0.132	0.146	STING_DROME Stimulator of interferon genes protein homolog OS=Drosophila melanogaster OX=7227 GN=Sting PE=1 SV=1
13	P03314	0.32	35.8	3411	0.058	0.006	POLG_YEFV1 Genome polyprotein OS=Yellow fever virus (strain 17D vaccine) OX=11090 PE=1 SV=1
14	A0A140LH61	3.3	32.3	1151	0.055	0.018	A0A140LH61_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=1
15	F1RCC9	3.6	32.3	1179	0.055	0.018	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
16	Q7RTX7	5.7	31.6	472	0.074	0.059	CTSR4_HUMAN Cation channel sperm-associated protein 4 OS=Homo sapiens OX=9606 GN=CATSPER4 PE=1 SV=1
17	P75830	6.8	31.2	371	0.058	0.059	MACA_ECOLI Macrolide export protein MacA OS=Escherichia coli (strain K12) OX=83333 GN=macA PE=1 SV=2
18	Q6FXG1	8.1	31.2	2124	0.053	0.009	Q6FXG1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CCH1 PE=4 SV=1
19	Q39009	8.4	30.8	344	0.053	0.058	DMC1_ARATH Meiotic recombination protein DMC1 homolog OS=Arabidopsis thaliana OX=3702 GN=DMC1 PE=1 SV=2
20	Q5A936	8.5	31.2	2254	0.047	0.008	Q5A936_CANAL Cch1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCH1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01349 Flavi_NS4B	1.7e+02	13.0	Flavivirus non-structural protein NS4B
2	PF15009 TMEM173	3.8e-113	389.0	Transmembrane protein 173

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331288

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329967	0.999	Serine/threonine-protein kinase TBK1
2	9606.ENSP00000401980	0.995	Mitochondrial antiviral-signaling protein
3	9606.ENSP00000357113	0.994	Gamma-interferon-inducible protein 16
4	9606.ENSP00000359339	0.994	Cyclic GMP-AMP synthase
5	9606.ENSP00000471896	0.988	Interferon regulatory factor 3
6	9606.ENSP00000422753	0.978	Probable ATP-dependent RNA helicase DDX41
7	9606.ENSP00000464030	0.965	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
8	9606.ENSP00000272317	0.946	Ubiquitin-40S ribosomal protein S27a
9	9606.ENSP00000352039	0.935	NLR family CARD domain-containing protein 3
10	9606.ENSP00000352257	0.915	X-ray repair cross-complementing protein 6
11	9606.ENSP00000313420	0.907	DNA-dependent protein kinase catalytic subunit
12	9606.ENSP00000325863	0.905	Double-strand break repair protein MRE11
13	9606.ENSP00000375978	0.902	X-ray repair cross-complementing protein 5
14	9606.ENSP00000304697	0.900	Polyubiquitin-B
15	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
16	9606.ENSP00000441543	0.900	Polyubiquitin-C
17	9606.ENSP00000369213	0.898	Probable ATP-dependent RNA helicase DDX58
18	9606.ENSP00000360891	0.861	Interferon-induced protein with tetratricopeptide repeats 2
19	9606.ENSP00000305161	0.847	E3 ubiquitin-protein ligase TRIM56
20	9606.ENSP00000408292	0.811	E3 ubiquitin-protein ligase TRIM32

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0042803	1.000	protein homodimerization activity
GO:0061507	1.000	2',3'-cyclic GMP-AMP binding
GO:0035438	0.910	cyclic-di-GMP binding
GO:0019901	0.841	protein kinase binding
GO:0061629	0.831	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.991	cellular process
GO:0009893	0.988	positive regulation of metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0051716	0.980	cellular response to stimulus
GO:0008152	0.978	metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0032479	0.977	regulation of type I interferon production
GO:0051173	0.974	positive regulation of nitrogen compound metabolic process
GO:0051252	0.973	regulation of RNA metabolic process
GO:0031328	0.970	positive regulation of cellular biosynthetic process
GO:0045089	0.969	positive regulation of innate immune response
GO:0032481	0.964	positive regulation of type I interferon production
GO:0022607	0.958	cellular component assembly
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0016241	0.944	regulation of macroautophagy
GO:0006950	0.941	response to stress
GO:0045935	0.940	positive regulation of nucleobase-containing compound metabolic process
GO:0009615	0.937	response to virus
GO:0014070	0.932	response to organic cyclic compound
GO:0044237	0.917	cellular metabolic process
GO:0010557	0.917	positive regulation of macromolecule biosynthetic process
GO:0002253	0.916	activation of immune response
GO:0071407	0.913	cellular response to organic cyclic compound
GO:0010508	0.908	positive regulation of autophagy
GO:0045087	0.905	innate immune response
GO:0051607	0.879	defense response to virus
GO:0009966	0.872	regulation of signal transduction
GO:0016239	0.854	positive regulation of macroautophagy
GO:0002218	0.852	activation of innate immune response
GO:0045893	0.844	positive regulation of DNA-templated transcription
GO:0006357	0.834	regulation of transcription by RNA polymerase II
GO:0060759	0.831	regulation of response to cytokine stimulus
GO:0009967	0.831	positive regulation of signal transduction
GO:0032728	0.778	positive regulation of interferon-beta production
GO:0001959	0.766	regulation of cytokine-mediated signaling pathway
GO:0060338	0.715	regulation of type I interferon-mediated signaling pathway
GO:0060760	0.705	positive regulation of response to cytokine stimulus
GO:0001961	0.665	positive regulation of cytokine-mediated signaling pathway
GO:0009056	0.651	catabolic process
GO:0006996	0.643	organelle organization
GO:0044248	0.637	cellular catabolic process
GO:0065009	0.621	regulation of molecular function
GO:0006914	0.617	autophagy
GO:0044093	0.611	positive regulation of molecular function
GO:0000045	0.600	autophagosome assembly
GO:0043933	0.584	protein-containing complex organization
GO:0065003	0.573	protein-containing complex assembly
GO:0071704	0.452	organic substance metabolic process
GO:0044238	0.305	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005829	0.997	cytosol
GO:0005654	0.997	nucleoplasm
GO:0005783	0.987	endoplasmic reticulum
GO:0031090	0.985	organelle membrane
GO:0032991	0.982	protein-containing complex
GO:0031984	0.977	organelle subcompartment
GO:0042175	0.971	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.952	endoplasmic reticulum subcompartment
GO:0031982	0.917	vesicle
GO:0031410	0.913	cytoplasmic vesicle
GO:0098588	0.884	bounding membrane of organelle
GO:0005789	0.843	endoplasmic reticulum membrane
GO:0005886	0.737	plasma membrane
GO:0005739	0.733	mitochondrion
GO:0005794	0.731	Golgi apparatus
GO:0030659	0.713	cytoplasmic vesicle membrane
GO:0005773	0.695	vacuole
GO:0031975	0.677	envelope
GO:0031967	0.588	organelle envelope
GO:0000139	0.549	Golgi membrane
GO:0019867	0.544	outer membrane
GO:0098796	0.534	membrane protein complex
GO:0031966	0.529	mitochondrial membrane
GO:0005768	0.526	endosome
GO:0031968	0.495	organelle outer membrane
GO:0005741	0.446	mitochondrial outer membrane
GO:0000421	0.368	autophagosome membrane
GO:1990231	0.364	STING complex
GO:0099503	0.353	secretory vesicle
GO:0043232	0.345	intracellular non-membrane-bounded organelle
GO:0030141	0.337	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]