StarFunc result for job id Q86WZ0

User Input

>input (1026 residues)
MTRTQKGKTFLPHCFYQSLPPRLGWGMILNYSKLKGKEECASVSSVPMVFFSSQYRLHRK
SQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYNTNDIIHTPQIRKARPQKPVSFK
FLGSSSPLTGDTSLAVKTESSANPEKKLKKSKPASTVREAPRPLIHHPCMHPDMLGRPPS
LDVNLEEREAWLLPPEKEARAWEATVLEKLNERTARWIQSKRPRRPGASPNKWQSFLRQQ
YDWSHIRDELTSASDLELLKQLEAEETAEFEDQSVILPPQEKKKPELLLPVYYRLPSYFQ
QAETVEIMPGNKSTEDIHEKTSLSQPQTQSYFRQVTPRAGKFAYSTDNTFEQEIYFDEVQ
IIHQIGAKRDQIVLENLNRYNKQLSKVFPETPEKWSAQAIPEASYRPVQGALRWTALPTP
AKDMLLQVGEKDVPIKTRRLKKQAKSLQEDVTWELVVLRRMLKEWKTAWALIIEWHHETV
ENLLQSLGDLHDDVRIKAITTCATAALERPRIATSQRDSDKTIQDLPEVLLPALEAALCD
KNAHVRMAAAICQYAIQSHNPLARNIMQTALLKGNSVDSWAAAQCLALEGTATYPVIKRI
LHQLFTKKNEDTEEQSYILLSYLSEKTTLIHTMLAVELNSCQWKNRIVACQAFSRISGNV
CLDMKHKLIQLMWNDWNKEVRRAAAQALGQMSLGKEVHDIIRVKLGQGNSQERVEALYLI
GELKLMTAKLLPSFLHCFSDDFTAVRRAACLAAGALQIRDKMVLECLLNLMQRDPYWKIK
AFAIRALGQIGQVSPELTDLLLWAIHYEESPGVRLEACRSILALKLQGDRVRDTFLDVLL
LENHDAVLKEMYQTMKILNLGNEGNQEMLQEIKNRIKTLSQKDLLTHKILKLEMVMGKVR
EEAKRVYLKPKGEQGPLTLQTLLQETFQDEMVLPRRPSEVCDTEAVIKPVKPRAPNPWLQ
SSVPGLTTRSKVRSSLVKDLRTSPEKRIAVGPFRSDYPALYLGKFSERTFFSPIMSSPSG
KKGAHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VPR5	0.172	0.138	5.894E-8	1340	0.114	0.087	Q9VPR5.pdb.gz	Q9VPR5_DROME Splicing factor 3b subunit 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sf3b1 PE=1 SV=2
2	PDB:1b3uA	0.218	0.324	3.234E-7	588	0.070	0.122	1b3uA.pdb.gz
3	PDB:7sn8D	0.146	0.335	4.048E-7	399	0.062	0.160	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
4	PDB:7cunG	0.196	0.215	6.634E-7	895	0.058	0.066	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
5	AFDB:Q55FT4	0.151	0.080	8.340E-7	2247	0.125	0.057	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
6	PDB:1wa5B	0.160	0.296	1.244E-6	466	0.067	0.148	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
7	PDB:5tbkA	0.168	0.351	1.423E-6	417	0.061	0.151	5tbkA.pdb.gz
8	PDB:4tnmA	0.115	0.239	2.132E-6	407	0.061	0.155	4tnmA.pdb.gz
9	PDB:3w3zA	0.239	0.242	2.440E-6	1013	0.080	0.081	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
10	AFDB:Q07807	0.167	0.189	2.804E-6	879	0.102	0.119	Q07807.pdb.gz	PUF3_YEAST mRNA-binding protein PUF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF3 PE=1 SV=1
11	PDB:7rroH7	0.134	0.212	3.655E-6	580	0.074	0.131	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	AFDB:Q0WQK1	0.213	0.223	3.671E-6	961	0.117	0.125	Q0WQK1.pdb.gz	Q0WQK1_ARATH Uncharacterized protein At1g27595 OS=Arabidopsis thaliana OX=3702 GN=At1g27595 PE=2 SV=1
13	PDB:3nd2A	0.194	0.225	4.182E-6	861	0.066	0.079	3nd2A.pdb.gz
14	PDB:3tpoA	0.163	0.320	4.575E-6	438	0.054	0.126	3tpoA.pdb.gz
15	AFDB:Q553Y8	0.079	0.085	4.595E-6	941	0.074	0.081	Q553Y8.pdb.gz	Q553Y8_DICDI Cell differentiation family, Rcd1-like protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275289 PE=3 SV=1
16	AFDB:F4IKX0	0.102	0.096	1.545E-5	1108	0.124	0.115	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
17	AFDB:P25822	0.122	0.093	1.616E-5	1533	0.120	0.080	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
18	AFDB:Q9BWH6	0.119	0.099	4.540E-5	1393	0.134	0.098	Q9BWH6.pdb.gz	RPAP1_HUMAN RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1 PE=1 SV=3
19	AFDB:V6CLK4	0.076	0.086	4.966E-5	855	0.108	0.130	V6CLK4.pdb.gz	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
20	AFDB:G5EB71	0.101	0.122	5.682E-5	778	0.114	0.150	G5EB71.pdb.gz	G5EB71_EMENI Rad26-like helical repeats domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05165 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RTY3	0.36	37.0	570	0.046	0.082	HEAT9_HUMAN Protein HEATR9 OS=Homo sapiens OX=9606 GN=HEATR9 PE=1 SV=2
2	Q92616	2.4	34.7	2671	0.043	0.016	GCN1_HUMAN Stalled ribosome sensor GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=7
3	E9PVA8	2.6	34.7	2671	0.043	0.016	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
4	Q8BKC5	2.9	34.3	1097	0.036	0.034	IPO5_MOUSE Importin-5 OS=Mus musculus OX=10090 GN=Ipo5 PE=1 SV=3
5	O00410	3.0	34.3	1097	0.036	0.034	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
6	Q9VN44	4.4	33.9	1105	0.023	0.022	Q9VN44_DROME FI07923p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=1 SV=1
7	F7ABZ6	4.8	33.9	4534	0.016	0.004	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
8	O14134	4.9	33.5	1057	0.023	0.023	ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elf1 PE=1 SV=1
9	D3YYQ8	5.0	33.9	4591	0.016	0.003	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
10	O74539	5.4	33.5	2344	0.031	0.014	MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak3 PE=1 SV=1
11	Q07993	5.4	33.1	356	0.023	0.067	XYL2_YEAST D-xylulose reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=XYL2 PE=1 SV=1
12	Q07623	8.2	32.0	225	0.027	0.124	NOP6_YEAST Nucleolar protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	0.086	24.4	non-SMC mitotic condensation complex subunit 1
2	PF11865 DUF3385	2.5e+02	13.0	Domain of unknown function (DUF3385)
3	PF02985 HEAT	1.3e-15	67.2	HEAT repeat
4	PF13646 HEAT_2	4.5e-19	79.9	HEAT repeats
5	PF13513 HEAT_EZ	8.6e-05	34.3	HEAT-like repeat
6	PF03130 HEAT_PBS	0.97	21.2	PBS lyase HEAT-like repeat
7	PF14668 RICTOR_V	2.8e+02	13.1	Rapamycin-insensitive companion of mTOR, domain 5
8	PF12397 U3snoRNP10	3.6e+02	12.9	U3 small nucleolar RNA-associated protein 10

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000450444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261778	0.770	Transport and golgi organization 6 homolog
2	9606.ENSP00000216036	0.744	Radial spoke head 14 homolog
3	9606.ENSP00000184956	0.650	HEAT repeat-containing protein 6
4	9606.ENSP00000434466	0.649	Integrator complex subunit 4
5	9606.ENSP00000381198	0.645	LisH domain and HEAT repeat-containing protein KIAA1468
6	9606.ENSP00000295709	0.629	Serine/threonine-protein kinase 36
7	9606.ENSP00000297440	0.629	Dynein assembly factor 5, axonemal
8	9606.ENSP00000396234	0.568	DEP domain containing 4
9	9606.ENSP00000357199	0.561	Protein RRNAD1
10	9606.ENSP00000467931	0.524	Zinc finger protein 461
11	9606.ENSP00000396622	0.520	Maestro heat like repeat family member 7
12	9606.ENSP00000381857	0.515	Maestro heat like repeat family member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.343	organic cyclic compound binding
GO:1901363	0.338	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0030154	0.620	cell differentiation
GO:0048856	0.599	anatomical structure development
GO:0071840	0.452	cellular component organization or biogenesis
GO:0051179	0.388	localization
GO:0016043	0.387	cellular component organization
GO:0051234	0.331	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043231	0.865	intracellular membrane-bounded organelle
GO:0005634	0.667	nucleus
GO:0043232	0.593	intracellular non-membrane-bounded organelle
GO:0005829	0.475	cytosol
GO:0120025	0.319	plasma membrane bounded cell projection
GO:0005929	0.300	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]