StarFunc result for job id Q86X10

User Input

>input (1494 residues)
MYSEWRSLHLVIQNDQGHTSVLHSYPESVGREVANAVVRPLGQVLGTPSVAGSENLLKTD
KEVKWTMEVICYGLTLPLDGETVKYCVDVYTDWIMALVLPKDSIPLPVIKEPNQYVQTIL
KHLQNLFVPRQEQGSSQIRLCLQVLRAIQKLARESSLMARETWEVLLLFLLQINDILLAP
PTVQGGIAENLAEKLIGVLFEVWLLACTRCFPTPPYWKTAKEMVANWRHHPAVVEQWSKV
ICALTSRLLRFTYGPSFPAFKVPDEDASLIPPEMDNECVAQTWFRFLHMLSNPVDLSNPA
IISSTPKFQEQFLNVSGMPQELNQYPCLKHLPQIFFRAMRGISCLVDAFLGISRPRSDSA
PPTPVNRLSMPQSAAVSTTPPHNRRHRAVTVNKATMKTSTVSTAHASKVQHQTSSTSPLS
SPNQTSSEPRPLPAPRRPKVNSILNLFGSWLFDAAFVHCKLHNGINRDSSMTAITTQASM
EFRRKGSQMSTDTMVSNPMFDASEFPDNYEAGRAEACGTLCRIFCSKKTGEEILPAYLSR
FYMLLIQGLQINDYVCHPVLASVILNSPPLFCCDLKGIDVVVPYFISALETILPDRELSK
FKSYVNPTELRRSSINILLSLLPLPHHFGTVKSEVVLEGKFSNDDSSSYDKPITFLSLKL
RLVNILIGALQTETDPNNTQMILGAMLNIVQDSALLEAIGCQMEMGGGENNLKSHSRTNS
GISSASGGSTEPTTPDSERPAQALLRDYALNTDSAAGLLIRSIHLVTQRLNSQWRQDMSI
SLAALELLSGLAKVKVMVDSGDRKRAISSVCTYIVYQCSRPAPLHSRDLHSMIVAAFQCL
CVWLTEHPDMLDEKDCLKEVLEIVELGISGSKSKNNEQEVKYKGDKEPNPASMRVKDAAE
ATLTCIMQLLGAFPSPSGPASPCSLVNETTLIKYSRLPTINKHSFRYFVLDNSVILAMLE
QPLGNEQNDFFPSVTVLVRGMSGRLAWAQQLCLLPRGAKANQKLFVPEPRPVPKNDVGFK
YSVKHRPFPEEVDKIPFVKADLSIPDLHEIVTEELEERHEKLRSGMAQQIAYEIHLEQQS
EEELQKRSFPDPVTDCKPPPPAQEFQTARLFLSHFGFLSLEALKEPANSRLPPHLIALDS
TIPGFFDDIGYLDLLPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLG
WSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADALTE
IAFVVPSPVESLTDSLESNISDQDSDSNMDLMPGILKQPSLTLELFPNHTDNLNSSQRLS
PSSRMRKLPQGRPVPPLGPETRVSVVWVERYDDIENFPLSELMTEISTGVETTANSSTSL
RSTTLEKEVPVIFIHPLNTGLFRIKIQGATGKFNMVIPLVDGMIVSRRALGFLVRQTVIN
ICRRKRLESDSYSPPHVRRKQKITDIVNKYRNKQLEPEFYTSLFQEVGLKNCSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86X10	1.000	1.000	0.000	1494	1.000	1.000	Q86X10.pdb.gz	RLGPB_HUMAN Ral GTPase-activating protein subunit beta OS=Homo sapiens OX=9606 GN=RALGAPB PE=1 SV=1
2	AFDB:H9G2Q2	0.447	0.559	2.074E-37	1179	0.177	0.224	H9G2Q2.pdb.gz	H9G2Q2_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hgap-2 PE=1 SV=1
3	PDB:7dl2A	0.234	0.298	1.396E-9	1127	0.122	0.162	7dl2A.pdb.gz
4	PDB:7dl2B	0.352	0.478	3.201E-9	1042	0.117	0.168	7dl2B.pdb.gz
5	PDB:3m62A	0.126	0.171	1.025E-5	955	0.066	0.103	3m62A.pdb.gz
6	PDB:3w3uA	0.132	0.172	4.635E-5	1030	0.068	0.098	3w3uA.pdb.gz
7	PDB:7unkA	0.103	0.133	6.508E-5	1047	0.067	0.096	7unkA.pdb.gz
8	PDB:7wttK	0.111	0.141	7.288E-5	1022	0.066	0.097	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
9	AFDB:Q95YF0	0.087	0.093	9.550E-5	1378	0.092	0.100	Q95YF0.pdb.gz	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1
10	PDB:7pksb	0.093	0.122	1.063E-4	1047	0.074	0.105	7pksb.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
11	PDB:6xu2A	0.121	0.150	1.236E-4	1091	0.064	0.088	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
12	PDB:3nd2A	0.123	0.179	1.735E-4	861	0.080	0.139	3nd2A.pdb.gz
13	PDB:4jlqA	0.115	0.157	1.735E-4	840	0.068	0.120	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
14	AFDB:Q68CQ1	0.129	0.138	8.513E-4	1323	0.070	0.079	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
15	AFDB:Q9SXA1	0.116	0.088	1.339E-3	2028	0.098	0.072	Q9SXA1.pdb.gz	P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PI4KA1 PE=1 SV=2
16	AFDB:Q6ZQK0	0.117	0.117	1.390E-3	1506	0.087	0.086	Q6ZQK0.pdb.gz	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
17	AFDB:Q9XVI2	0.172	0.271	3.069E-3	811	0.070	0.128	Q9XVI2.pdb.gz	Q9XVI2_CAEEL SYmmetrical Sister cell hermaphrodite gonad defect OS=Caenorhabditis elegans OX=6239 GN=sys-1 PE=1 SV=1
18	AFDB:Q10435	0.115	0.107	3.437E-3	1647	0.077	0.070	Q10435.pdb.gz	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2
19	AFDB:P60330	0.105	0.084	6.526E-3	2118	0.074	0.052	P60330.pdb.gz	ESPL1_MOUSE Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=1
20	AFDB:D4A0Y2	0.107	0.076	1.239E-2	2452	0.106	0.065	D4A0Y2.pdb.gz	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P86410	0.0	2858	1484	0.954	0.961	RLGPB_RAT Ral GTPase-activating protein subunit beta OS=Rattus norvegicus OX=10116 GN=Ralgapb PE=1 SV=1
2	Q86X10	0.0	3089	1494	1.000	1.000	RLGPB_HUMAN Ral GTPase-activating protein subunit beta OS=Homo sapiens OX=9606 GN=RALGAPB PE=1 SV=1
3	Q8BQZ4	0.0	2940	1484	0.957	0.964	RLGPB_MOUSE Ral GTPase-activating protein subunit beta OS=Mus musculus OX=10090 GN=Ralgapb PE=1 SV=2
4	H9G2Q2	1.32e-33	144	1179	0.089	0.113	H9G2Q2_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hgap-2 PE=1 SV=1
5	Q6GYQ0	1.40e-08	62.4	2036	0.060	0.044	RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1
6	H7C1F9	1.73e-08	62.0	1740	0.057	0.049	H7C1F9_HUMAN Ral GTPase activating protein catalytic subunit alpha 2 (Fragment) OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=1
7	Q2PPJ7	2.43e-08	61.6	1873	0.057	0.045	RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=2
8	P86411	4.49e-07	57.4	1872	0.051	0.041	RGPA2_RAT Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Ralgapa2 PE=1 SV=1
9	A3KGS3	5.09e-07	57.4	1872	0.054	0.043	RGPA2_MOUSE Ral GTPase-activating protein subunit alpha-2 OS=Mus musculus OX=10090 GN=Ralgapa2 PE=1 SV=2
10	Q6GYP7	8.25e-07	56.6	2035	0.060	0.044	RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus OX=10090 GN=Ralgapa1 PE=1 SV=1
11	V6CLC2	0.004	44.7	1306	0.017	0.020	V6CLC2_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hgap-1 PE=1 SV=1
12	Q99NG0	0.75	37.0	1466	0.017	0.018	ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus OX=10090 GN=Rad54l2 PE=1 SV=1
13	Q9Y4B4	1.9	35.4	1467	0.017	0.018	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
14	Q9P2F8	4.2	34.7	1722	0.019	0.016	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
15	Q8IMH4	6.0	33.9	876	0.015	0.026	Q8IMH4_DROME Saposin-related, isoform B OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=1 SV=2
16	Q9U9P3	6.6	33.5	441	0.015	0.052	Q9U9P3_DROME Ecdysone dependent glycoprotein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=2 SV=1
17	Q9Y125	7.6	33.5	953	0.015	0.024	Q9Y125_DROME BcDNA.GH08312 OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=1 SV=1
18	P36157	9.9	32.7	363	0.018	0.074	MSA2_YEAST Putative transcriptional activator MSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20412 RALGAPB_N	9.9e-31	117.8	RALGAPB N-terminal domain
2	PF02145 Rap_GAP	68	14.4	Rap/ran-GAP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262879

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005257	0.966	Ras-related protein Ral-A
2	9606.ENSP00000202677	0.933	Ral GTPase-activating protein subunit alpha-2
3	9606.ENSP00000375892	0.903	RAC-beta serine/threonine-protein kinase
4	9606.ENSP00000219476	0.652	Tuberin
5	9606.ENSP00000302647	0.610	Ral GTPase-activating protein subunit alpha-1
6	9606.ENSP00000303580	0.600	NF-kappa-B inhibitor-interacting Ras-like protein 2
7	9606.ENSP00000230449	0.599	Exocyst complex component 2
8	9606.ENSP00000306344	0.546	Transmembrane protein 135
9	9606.ENSP00000233099	0.540	HEAT repeat-containing protein 5B
10	9606.ENSP00000272519	0.540	Ras-related protein Ral-B
11	9606.ENSP00000410689	0.532	Actin filament-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043087	0.997	regulation of GTPase activity
GO:0050789	0.985	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0090630	0.969	activation of GTPase activity
GO:0051716	0.842	cellular response to stimulus
GO:0023052	0.793	signaling
GO:0007154	0.724	cell communication
GO:0007165	0.689	signal transduction
GO:0007264	0.470	small GTPase mediated signal transduction
GO:0032879	0.394	regulation of localization
GO:0007265	0.337	Ras protein signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.837	membrane-bounded organelle
GO:0043229	0.834	intracellular organelle
GO:0016020	0.823	membrane
GO:0043231	0.812	intracellular membrane-bounded organelle
GO:0005634	0.537	nucleus
GO:0032991	0.359	protein-containing complex
GO:0071944	0.321	cell periphery
GO:0012505	0.311	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]