StarFunc result for job id Q86X24

User Input

>input (394 residues)
MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDD
LCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFK
YTNNGPLMDFISKNQSNESSMLSTDTKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYY
DEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMENIDSTI
LSPKQIKTPFQKILRDKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDE
IMRSKESPDLSISHSQVEQLVNKTSELDMSESKTRSGKVFQNKMANGNQPVKSSKENRKR
SQHESGRIVLHHFDSSSQESVPKRRKFSEPKEHI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86X24	1.000	1.000	8.492E-73	394	1.000	1.000	Q86X24.pdb.gz	HORM1_HUMAN HORMA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=HORMAD1 PE=1 SV=1
2	AFDB:Q9D5T7	0.674	0.677	1.597E-50	392	0.756	0.760	Q9D5T7.pdb.gz	HORM1_MOUSE HORMA domain-containing protein 1 OS=Mus musculus OX=10090 GN=Hormad1 PE=1 SV=1
3	AFDB:Q5SQP1	0.589	0.750	1.806E-34	306	0.373	0.480	Q5SQP1.pdb.gz	HORM2_MOUSE HORMA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Hormad2 PE=1 SV=1
4	AFDB:Q8N7B1	0.552	0.701	3.668E-32	307	0.368	0.472	Q8N7B1.pdb.gz	HORM2_HUMAN HORMA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=HORMAD2 PE=1 SV=2
5	AFDB:F4HRV8	0.472	0.316	1.006E-20	596	0.188	0.124	F4HRV8.pdb.gz	ASY1_ARATH Meiosis-specific protein ASY1 OS=Arabidopsis thaliana OX=3702 GN=ASY1 PE=1 SV=1
6	AFDB:Q76CY8	0.452	0.296	5.069E-20	610	0.211	0.136	Q76CY8.pdb.gz	PAIR2_ORYSJ Meiosis-specific protein PAIR2 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR2 PE=2 SV=1
7	PDB:4trkA	0.454	0.723	8.053E-16	242	0.127	0.207	4trkA.pdb.gz
8	AFDB:Q20305	0.463	0.515	1.173E-15	352	0.140	0.156	Q20305.pdb.gz	Q20305_CAEEL HORMA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=htp-1 PE=1 SV=2
9	PDB:6keaD	0.386	0.270	9.876E-12	584	0.079	0.053	6keaD.pdb.gz
10	PDB:4aezH	0.383	0.766	9.953E-11	185	0.081	0.173	4aezH.pdb.gz
11	PDB:2v64A	0.390	0.688	1.491E-10	210	0.094	0.176	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
12	PDB:3abdA	0.384	0.776	1.990E-10	180	0.069	0.150	3abdA.pdb.gz	Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase {zeta} and REV1
13	AFDB:Q55BY0	0.330	0.174	5.559E-8	798	0.109	0.054	Q55BY0.pdb.gz	Q55BY0_DICDI Autophagy-related protein 13 N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269162 PE=4 SV=1
14	AFDB:Q9VHR6	0.268	0.218	1.484E-7	523	0.145	0.109	Q9VHR6.pdb.gz	ATG13_DROME Autophagy-related protein 13 homolog OS=Drosophila melanogaster OX=7227 GN=Atg13 PE=1 SV=1
15	PDB:6bi7G	0.307	0.719	2.304E-6	154	0.058	0.149	6bi7G.pdb.gz	Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
16	AFDB:P34379	0.266	0.243	3.992E-6	443	0.127	0.113	P34379.pdb.gz	ATG13_CAEEL Autophagy-related protein 13 homolog OS=Caenorhabditis elegans OX=6239 GN=atg-13 PE=1 SV=1
17	PDB:7lxdE	0.267	0.472	3.309E-4	205	0.053	0.102	7lxdE.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
18	PDB:7lxdD	0.281	0.589	3.147E-3	163	0.061	0.147	7lxdD.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
19	PDB:4yk8A	0.183	0.385	4.233E-2	162	0.048	0.117	4yk8A.pdb.gz
20	PDB:6f0xP	0.231	0.408	1.268E-1	194	0.071	0.144	6f0xP.pdb.gz	Mechanism for remodelling of the cell cycle checkpoint protein MAD2 by the ATPase TRIP13.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86X24	0.0	816	394	1.000	1.000	HORM1_HUMAN HORMA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=HORMAD1 PE=1 SV=1
2	Q9D5T7	0.0	620	392	0.777	0.781	HORM1_MOUSE HORMA domain-containing protein 1 OS=Mus musculus OX=10090 GN=Hormad1 PE=1 SV=1
3	Q5SQP1	2.78e-98	296	306	0.360	0.464	HORM2_MOUSE HORMA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Hormad2 PE=1 SV=1
4	Q8N7B1	1.15e-88	272	307	0.345	0.443	HORM2_HUMAN HORMA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=HORMAD2 PE=1 SV=2
5	Q76CY8	2.53e-27	115	610	0.185	0.120	PAIR2_ORYSJ Meiosis-specific protein PAIR2 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR2 PE=2 SV=1
6	F4HRV8	2.01e-23	104	596	0.162	0.107	ASY1_ARATH Meiosis-specific protein ASY1 OS=Arabidopsis thaliana OX=3702 GN=ASY1 PE=1 SV=1
7	Q38B55	2.30e-15	79.3	423	0.162	0.151	Q38B55_TRYB2 HORMA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1530 PE=4 SV=1
8	G5EBG0	1.04e-13	73.2	291	0.137	0.186	G5EBG0_CAEEL HORMA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-3 PE=1 SV=1
9	F4JTJ9	4.16e-12	70.5	1399	0.155	0.044	ASY2_ARATH Meiosis-specific protein ASY2 OS=Arabidopsis thaliana OX=3702 GN=ASY2 PE=2 SV=1
10	P20050	7.93e-12	68.9	605	0.170	0.111	HOP1_YEAST Meiosis-specific protein HOP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOP1 PE=1 SV=2
11	Q20305	4.61e-05	47.4	352	0.107	0.119	Q20305_CAEEL HORMA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=htp-1 PE=1 SV=2
12	P05661	4.3	32.3	1962	0.058	0.012	MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4
13	P02564	7.5	31.6	1935	0.066	0.013	MYH7_RAT Myosin-7 OS=Rattus norvegicus OX=10116 GN=Myh7 PE=1 SV=2
14	P12883	7.8	31.2	1935	0.066	0.013	MYH7_HUMAN Myosin-7 OS=Homo sapiens OX=9606 GN=MYH7 PE=1 SV=5
15	Q57ZD6	8.4	30.4	201	0.058	0.114	Q57ZD6_TRYB2 Rev7, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.370 PE=4 SV=1
16	Q91Z83	8.6	31.2	1935	0.066	0.013	MYH7_MOUSE Myosin-7 OS=Mus musculus OX=10090 GN=Myh7 PE=2 SV=1
17	Q9LMM1	9.1	30.8	554	0.030	0.022	C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana OX=3702 GN=CYP86A4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02301 HORMA	7.3e-61	217.1	HORMA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383563	0.882	Zymogen granule membrane protein 16
2	9606.ENSP00000360310	0.851	Meiotic recombination protein SPO11
3	9606.ENSP00000166345	0.840	Pachytene checkpoint protein 2 homolog
4	9606.ENSP00000376658	0.840	Synaptonemal complex protein 3
5	9606.ENSP00000358535	0.810	Synaptonemal complex protein 1
6	9606.ENSP00000350162	0.793	Synaptonemal complex protein 2
7	9606.ENSP00000350036	0.742	Structural maintenance of chromosomes protein 1B
8	9606.ENSP00000465204	0.730	Cyclin N-terminal domain containing 1
9	9606.ENSP00000250535	0.726	Cysteine dioxygenase type 1
10	9606.ENSP00000296498	0.726	Neurotrypsin
11	9606.ENSP00000370419	0.726	Tetratricopeptide repeat domain containing
12	9606.ENSP00000379226	0.719	Testis-expressed protein 11
13	9606.ENSP00000391788	0.709	Interactor of HORMAD1 protein 1
14	9606.ENSP00000482546	0.699	Meiotic recombination protein REC8 homolog
15	9606.ENSP00000413632	0.696	Minichromosome maintenance domain-containing protein 2
16	9606.ENSP00000263187	0.684	MutS protein homolog 4
17	9606.ENSP00000350447	0.681	Shugoshin 2
18	9606.ENSP00000382794	0.674	Ring finger protein 212B
19	9606.ENSP00000301305	0.664	Zinc transporter ZIP4
20	9606.ENSP00000409896	0.658	E3 ubiquitin-protein ligase CCNB1IP1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0044238	0.984	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0006725	0.969	cellular aromatic compound metabolic process
GO:0034641	0.969	cellular nitrogen compound metabolic process
GO:0051716	0.963	cellular response to stimulus
GO:0051177	0.958	meiotic sister chromatid cohesion
GO:0045786	0.957	negative regulation of cell cycle
GO:0007127	0.947	meiosis I
GO:0007129	0.938	homologous chromosome pairing at meiosis
GO:0032501	0.923	multicellular organismal process
GO:0043170	0.919	macromolecule metabolic process
GO:0032502	0.903	developmental process
GO:0006139	0.896	nucleobase-containing compound metabolic process
GO:0090304	0.894	nucleic acid metabolic process
GO:0051128	0.877	regulation of cellular component organization
GO:0010948	0.870	negative regulation of cell cycle process
GO:0051129	0.822	negative regulation of cellular component organization
GO:0010639	0.810	negative regulation of organelle organization
GO:0032504	0.809	multicellular organism reproduction
GO:0023052	0.800	signaling
GO:2000241	0.798	regulation of reproductive process
GO:0070193	0.796	synaptonemal complex organization
GO:0051783	0.730	regulation of nuclear division
GO:2000242	0.714	negative regulation of reproductive process
GO:0048856	0.702	anatomical structure development
GO:0007154	0.689	cell communication
GO:0009790	0.683	embryo development
GO:0051784	0.646	negative regulation of nuclear division
GO:0048609	0.644	multicellular organismal reproductive process
GO:0022607	0.631	cellular component assembly
GO:0019953	0.510	sexual reproduction
GO:0007276	0.465	gamete generation
GO:0007165	0.458	signal transduction
GO:0051445	0.436	regulation of meiotic cell cycle
GO:1901987	0.418	regulation of cell cycle phase transition
GO:0001701	0.406	in utero embryonic development
GO:0000075	0.405	cell cycle checkpoint signaling
GO:0045835	0.405	negative regulation of meiotic nuclear division
GO:0090305	0.402	nucleic acid phosphodiester bond hydrolysis
GO:0048232	0.385	male gamete generation
GO:0007130	0.381	synaptonemal complex assembly
GO:0022412	0.371	cellular process involved in reproduction in multicellular organism
GO:0003006	0.357	developmental process involved in reproduction
GO:0001824	0.346	blastocyst development
GO:0007283	0.333	spermatogenesis
GO:0044260	0.305	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005737	0.989	cytoplasm
GO:0005694	0.887	chromosome
GO:0000793	0.632	condensed chromosome
GO:0099086	0.529	synaptonemal structure
GO:0000795	0.515	synaptonemal complex
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]