StarFunc result for job id Q86X53

User Input

>input (443 residues)
MAAHRKHVFVEKVLQRLFPPVPSGQGKREPQTLAVQNPPKKVTSEKVSQKHAEPLTDTGS
ETPTARRLYTASGPPEGYVPCWPEPSSCGSPENASSGDDTEDQDPHDQPKRRRIRKHKSK
KKFKNPNNVLIEQAELEKQQSLLQEKSQRQHTDGTTISKNKKRKLKKKQQIKRKKAAGLA
AKAAGVSFMYQPEDSSNEGEGVGEACEEDGVDTSEEDPTLAGEEDVKDTREEDGADASEE
DLTRARQEEGADASEEDPTPAGEEDVKDAREEDGVDTIEEDLTRAGEEDGKDTREEDGAD
ASEEDPTWAGEEEGADSGEEDGADASEEDDTITNEKAHSILNFLKSTQEMYFYDGVSRDA
ASAALADAAEELLDRLASHSMLPSDVSILYHMKTLLLLQDTERLKHALEMFPEHCTMPPD
HARVISAFFSYWITHILPEKSSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86X53	1.000	1.000	4.295E-57	443	1.000	1.000	Q86X53.pdb.gz	ERIC1_HUMAN Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1
2	AFDB:A0A0C4DGN6	0.076	0.052	1.570E-1	747	0.138	0.082	A0A0C4DGN6.pdb.gz	A0A0C4DGN6_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
3	AFDB:Q9QY06	0.092	0.026	1.760E-1	2114	0.129	0.027	Q9QY06.pdb.gz	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
4	AFDB:Q38C46	0.083	0.040	3.920E-1	1405	0.149	0.047	Q38C46.pdb.gz	Q38C46_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5860 PE=4 SV=1
5	PDB:5wsgf	0.182	0.442	4.237E-1	148	0.041	0.122	5wsgf.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
6	AFDB:Q5A5R4	0.065	0.033	5.218E-1	1189	0.144	0.054	Q5A5R4.pdb.gz	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
7	AFDB:Q57U81	0.073	0.041	5.525E-1	891	0.079	0.039	Q57U81.pdb.gz	Q57U81_TRYB2 Xrn1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.810 PE=4 SV=1
8	PDB:1x8zA	0.091	0.212	7.507E-1	151	0.034	0.099	1x8zA.pdb.gz
9	AFDB:Q64355	0.075	0.062	8.731E-1	560	0.126	0.100	Q64355.pdb.gz	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
10	PDB:4kxrB	0.102	0.227	8.912E-1	174	0.029	0.075	4kxrB.pdb.gz
11	AFDB:Q9TW28	0.105	0.041	1.098	1737	0.111	0.028	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
12	PDB:5ee3B	0.128	0.151	1.256	364	0.059	0.071	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
13	AFDB:Q08923	0.075	0.067	1.303	506	0.099	0.087	Q08923.pdb.gz	CTI6_YEAST Histone deacetylase complex subunit CTI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTI6 PE=1 SV=1
14	AFDB:Q8IQI0	0.071	0.033	1.380	1294	0.140	0.048	Q8IQI0.pdb.gz	Q8IQI0_DROME Sin3A-associated protein 130, isoform C OS=Drosophila melanogaster OX=7227 GN=Sap130 PE=1 SV=1
15	PDB:1cnt2	0.088	0.261	1.408	130	0.038	0.131	1cnt2.pdb.gz
16	PDB:6exna	0.143	0.327	1.672	171	0.025	0.064	6exna.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
17	PDB:7rkfR	0.109	0.139	1.672	296	0.036	0.054	7rkfR.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
18	PDB:1yo7A	0.114	0.292	1.985	120	0.029	0.108	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
19	PDB:7be8A	0.084	0.145	2.225	219	0.029	0.059	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.
20	PDB:1yviA	0.101	0.269	2.356	140	0.025	0.079	1yviA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86X53	0.0	905	443	1.000	1.000	ERIC1_HUMAN Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1
2	Q8IXT5	1.42e-07	56.2	1001	0.093	0.041	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
3	M9PC41	0.027	39.7	22743	0.158	0.003	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
4	M9PB30	0.032	39.3	22949	0.158	0.003	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
5	M9PEI1	0.032	39.3	21657	0.158	0.003	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	M9PBZ0	0.035	39.3	22830	0.158	0.003	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PC45	0.035	39.3	22300	0.158	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PB32	0.036	39.3	19560	0.158	0.004	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PB31	0.037	39.3	20404	0.158	0.003	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PEH5	0.037	39.3	20710	0.158	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PBZ4	0.042	38.9	18014	0.158	0.004	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PCJ8	0.065	38.5	14825	0.158	0.005	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9NCR4	0.066	38.5	15105	0.158	0.005	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9NER8	0.070	38.1	15638	0.158	0.004	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	Q8I3A0	0.098	37.7	2568	0.081	0.014	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
16	Q640L3	0.40	35.8	753	0.045	0.027	CCPG1_MOUSE Cell cycle progression protein 1 OS=Mus musculus OX=10090 GN=Ccpg1 PE=1 SV=2
17	Q8IDX6	0.56	35.4	3130	0.090	0.013	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
18	Q5U2Y9	2.4	33.1	727	0.084	0.051	LCA5_RAT Lebercilin OS=Rattus norvegicus OX=10116 GN=Lca5 PE=2 SV=1
19	A1Z1Q3	5.4	32.0	425	0.043	0.045	MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=2
20	A0A2R8YFN3	5.9	31.6	453	0.043	0.042	A0A2R8YFN3_HUMAN Mono-ADP ribosylhydrolase 2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430325	0.815	Contributes to normal sperm motility, but not essential for male fertility
2	9606.ENSP00000400258	0.781	Disks large-associated protein 2
3	9606.ENSP00000356104	0.682	N-fatty-acyl-amino acid synthase/hydrolase PM20D1
4	9606.ENSP00000381613	0.681	Zinc finger protein 596
5	9606.ENSP00000334040	0.654	Round spermatid basic protein 1 like
6	9606.ENSP00000369636	0.620	PX domain containing 1
7	9606.ENSP00000372274	0.618	F-box only protein 25
8	9606.ENSP00000380718	0.595	Chromodomain Y-like protein
9	9606.ENSP00000361486	0.587	Phosphorylated CTD-interacting factor 1
10	9606.ENSP00000384048	0.561	PAX-interacting protein 1
11	9606.ENSP00000442573	0.526	Zinc finger protein 668
12	9606.ENSP00000340297	0.518	Rho guanine nucleotide exchange factor 10
13	9606.ENSP00000385028	0.515	Solute carrier family 22 member 23
14	9606.ENSP00000321812	0.504	Zinc finger protein 776

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.956	cellular process
GO:0065007	0.892	biological regulation
GO:0050789	0.597	regulation of biological process
GO:0032502	0.584	developmental process
GO:0050794	0.443	regulation of cellular process
GO:0071704	0.361	organic substance metabolic process
GO:0032501	0.313	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.989	cytoplasm
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0016020	0.456	membrane
GO:0005829	0.442	cytosol
GO:0005730	0.436	nucleolus
GO:0032991	0.398	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]