StarFunc result for job id Q86X55

User Input

>input (608 residues)
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4AE70	0.687	0.644	0.000	651	0.977	0.912	Q4AE70.pdb.gz	CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus OX=10116 GN=Carm1 PE=1 SV=1
2	AFDB:Q6DC04	0.677	0.699	2.930E-100	588	0.827	0.855	Q6DC04.pdb.gz	CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio OX=7955 GN=carm1 PE=2 SV=1
3	AFDB:Q7Q2B7	0.630	0.617	1.883E-74	622	0.488	0.477	Q7Q2B7.pdb.gz	CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae OX=7165 GN=CARM1 PE=1 SV=5
4	AFDB:Q9VH48	0.652	0.744	4.478E-72	530	0.447	0.513	Q9VH48.pdb.gz	CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster OX=7227 GN=Art4 PE=1 SV=1
5	AFDB:Q84W92	0.571	0.647	1.390E-57	535	0.317	0.361	Q84W92.pdb.gz	ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana OX=3702 GN=PRMT13 PE=1 SV=3
6	AFDB:A3KPF2	0.578	0.663	1.280E-54	528	0.311	0.358	A3KPF2.pdb.gz	ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana OX=3702 GN=PRMT14 PE=1 SV=1
7	AFDB:O70467	0.490	0.561	6.639E-35	528	0.191	0.220	O70467.pdb.gz	ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1
8	AFDB:Q6NZB1	0.478	0.753	1.417E-34	378	0.201	0.323	Q6NZB1.pdb.gz	ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus OX=10090 GN=Prmt6 PE=1 SV=2
9	AFDB:Q9R144	0.474	0.633	2.071E-34	448	0.202	0.275	Q9R144.pdb.gz	ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus OX=10090 GN=Prmt2 PE=1 SV=1
10	AFDB:D9IVE5	0.486	0.671	2.308E-34	432	0.189	0.266	D9IVE5.pdb.gz	ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis OX=8355 GN=prmt2 PE=1 SV=2
11	PDB:4y2hB	0.477	0.799	1.592E-33	352	0.204	0.352	4y2hB.pdb.gz	Aryl Pyrazoles as Potent Inhibitors of Arginine Methyltransferases: Identification of the First PRMT6 Tool Compound.
12	PDB:6nt2A	0.485	0.871	1.181E-30	330	0.184	0.339	6nt2A.pdb.gz	Anti-tumor Activity of the Type I PRMT Inhibitor, GSK3368715, Synergizes with PRMT5 Inhibition through MTAP Loss.
13	PDB:3r0qG	0.500	0.843	4.829E-30	353	0.184	0.317	3r0qG.pdb.gz	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.
14	PDB:6dnzA	0.471	0.878	5.382E-30	317	0.191	0.366	6dnzA.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
15	PDB:1g6q1	0.468	0.843	8.758E-28	328	0.188	0.348	1g6q1.pdb.gz
16	PDB:6dnzB	0.440	0.795	2.582E-21	319	0.125	0.238	6dnzB.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
17	PDB:4lwpB	0.405	0.698	1.916E-20	342	0.146	0.260	4lwpB.pdb.gz	Crystal Structure of Arginine Methyltransferase 6 from Trypanosoma brucei
18	PDB:4c4aA	0.397	0.378	1.208E-17	641	0.117	0.111	4c4aA.pdb.gz	Structural Insight Into Arginine Methylation by the Mouse Protein Arginine Methyltransferase 7: A Zinc Finger Freezes the Mimic of the Dimeric State Into a Single Active Site.
19	PDB:4g56A	0.416	0.410	1.275E-17	617	0.112	0.110	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
20	PDB:7bo7AAA	0.399	0.389	1.460E-16	625	0.113	0.110	7bo7AAA.pdb.gz	CRYSTAL STRUCTURE OF THE HUMAN PRMT5:MEP50 COMPLEX with JNJB44355437

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4AE70	0.0	1162	651	0.936	0.874	CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus OX=10116 GN=Carm1 PE=1 SV=1
2	Q6DC04	0.0	1063	588	0.827	0.855	CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio OX=7955 GN=carm1 PE=2 SV=1
3	Q7Q2B7	0.0	573	622	0.456	0.445	CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae OX=7165 GN=CARM1 PE=1 SV=5
4	Q86X55	0.0	1267	608	1.000	1.000	CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3
5	Q9VH48	0.0	571	530	0.434	0.498	CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster OX=7227 GN=Art4 PE=1 SV=1
6	Q9WVG6	0.0	1239	608	0.979	0.979	CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus OX=10090 GN=Carm1 PE=1 SV=2
7	Q84W92	6.26e-121	370	535	0.304	0.346	ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana OX=3702 GN=PRMT13 PE=1 SV=3
8	A3KPF2	1.32e-114	353	528	0.311	0.358	ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana OX=3702 GN=PRMT14 PE=1 SV=1
9	Q9SU94	1.95e-57	200	390	0.202	0.315	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
10	Q63009	8.46e-57	197	353	0.189	0.326	ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Prmt1 PE=1 SV=1
11	Q9JIF0	1.39e-56	197	371	0.189	0.310	ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus OX=10090 GN=Prmt1 PE=1 SV=1
12	Q99873	9.44e-56	195	371	0.188	0.307	ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3
13	Q9VGW7	1.04e-55	195	376	0.196	0.316	Q9VGW7_DROME Arginine methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Art1 PE=1 SV=1
14	Q6VRB0	1.52e-55	194	351	0.186	0.322	ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=prmt1-b PE=1 SV=1
15	F1R3J9	2.64e-55	193	348	0.186	0.325	F1R3J9_DANRE Protein arginine N-methyltransferase 1 OS=Danio rerio OX=7955 GN=fb39h07 PE=1 SV=1
16	Q9NR22	3.49e-55	194	394	0.188	0.289	ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2
17	Q8AV13	4.27e-55	193	369	0.183	0.301	ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis OX=8355 GN=prmt1-a PE=1 SV=1
18	Q96LA8	6.06e-55	192	375	0.206	0.333	ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens OX=9606 GN=PRMT6 PE=1 SV=1
19	Q5RGQ2	7.43e-55	194	419	0.191	0.277	ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio OX=7955 GN=prmt8b PE=2 SV=2
20	Q9URX7	1.03e-54	191	340	0.192	0.344	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11531 CARM1	1.2e-58	207.4	Coactivator-associated arginine methyltransferase 1 N terminal
2	PF02353 CMAS	39	15.0	Mycolic acid cyclopropane synthetase
3	PF03602 Cons_hypoth95	91	14.1	Conserved hypothetical protein 95
4	PF05219 DREV	4.4e+02	11.3	DREV methyltransferase
5	PF08241 Methyltransf_11	0.016	27.2	Methyltransferase domain
6	PF08242 Methyltransf_12	15	17.8	Methyltransferase domain
7	PF12847 Methyltransf_18	2.6	19.5	Methyltransferase domain
8	PF13489 Methyltransf_23	0.14	23.4	Methyltransferase domain
9	PF13649 Methyltransf_25	1.2e-05	37.2	Methyltransferase domain
10	PF13847 Methyltransf_31	0.33	22.2	Methyltransferase domain
11	PF13679 Methyltransf_32	1.5e+02	13.8	Methyltransferase domain
12	PF08003 Methyltransf_9	0.0048	27.5	Protein of unknown function (DUF1698)
13	PF02475 Met_10	52	15.0	Met-10+ like-protein
14	PF05175 MTS	6.8e-05	34.1	Methyltransferase small domain
15	PF06325 PrmA	3.3e-07	41.6	Ribosomal protein L11 methyltransferase (PrmA)
16	PF05185 PRMT5	0.068	24.5	PRMT5 arginine-N-methyltransferase
17	PF17286 PRMT5_C	1.6e+02	13.6	PRMT5 oligomerisation domain
18	PF03848 TehB	45	14.9	Tellurite resistance protein TehB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325690

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.998	Histone acetyltransferase p300
2	9606.ENSP00000361066	0.998	Nuclear receptor coactivator 3
3	9606.ENSP00000262367	0.995	CREB-binding protein
4	9606.ENSP00000269305	0.995	Cellular tumor antigen p53
5	9606.ENSP00000399968	0.995	Nuclear receptor coactivator 2
6	9606.ENSP00000405330	0.994	Estrogen receptor
7	9606.ENSP00000395654	0.988	Transcription activator BRG1
8	9606.ENSP00000381098	0.974	Glutamate receptor-interacting protein 1
9	9606.ENSP00000480826	0.960	Histone cluster 1 H3 family member a
10	9606.ENSP00000363822	0.959	Androgen receptor
11	9606.ENSP00000385216	0.949	Nuclear receptor coactivator 1
12	9606.ENSP00000231509	0.943	Glucocorticoid receptor
13	9606.ENSP00000301396	0.940	Proline-, glutamic acid- and leucine-rich protein 1
14	9606.ENSP00000344456	0.939	Catenin beta-1
15	9606.ENSP00000360025	0.937	Growth arrest and DNA damage-inducible protein GADD45 alpha
16	9606.ENSP00000406162	0.937	Protein arginine N-methyltransferase 1
17	9606.ENSP00000313007	0.934	Polyadenylate-binding protein 1
18	9606.ENSP00000480158	0.933	DNA-directed RNA polymerase II subunit RPB1
19	9606.ENSP00000254066	0.929	Retinoic acid receptor alpha
20	9606.ENSP00000476960	0.929	Histone cluster 2 H3 pseudogene 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042054	1.000	histone methyltransferase activity
GO:0016274	1.000	protein-arginine N-methyltransferase activity
GO:0003713	0.998	transcription coactivator activity
GO:0008469	0.994	histone arginine N-methyltransferase activity
GO:0140938	0.774	histone H3 methyltransferase activity
GO:0035242	0.758	protein-arginine omega-N asymmetric methyltransferase activity
GO:1901363	0.733	heterocyclic compound binding
GO:0097159	0.732	organic cyclic compound binding
GO:0003676	0.713	nucleic acid binding
GO:0042802	0.580	identical protein binding
GO:0035241	0.417	protein-arginine omega-N monomethyltransferase activity
GO:0003677	0.304	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0010556	0.990	regulation of macromolecule biosynthetic process
GO:0043170	0.987	macromolecule metabolic process
GO:0031326	0.986	regulation of cellular biosynthetic process
GO:0048518	0.985	positive regulation of biological process
GO:0010468	0.985	regulation of gene expression
GO:1903506	0.982	regulation of nucleic acid-templated transcription
GO:0051254	0.977	positive regulation of RNA metabolic process
GO:0006355	0.950	regulation of DNA-templated transcription
GO:0044260	0.859	cellular macromolecule metabolic process
GO:0031328	0.851	positive regulation of cellular biosynthetic process
GO:0010557	0.850	positive regulation of macromolecule biosynthetic process
GO:1902680	0.835	positive regulation of RNA biosynthetic process
GO:1903508	0.833	positive regulation of nucleic acid-templated transcription
GO:0050896	0.762	response to stimulus
GO:0045893	0.742	positive regulation of DNA-templated transcription
GO:0051716	0.452	cellular response to stimulus
GO:0048523	0.425	negative regulation of cellular process
GO:0006357	0.419	regulation of transcription by RNA polymerase II
GO:1901360	0.418	organic cyclic compound metabolic process
GO:1901564	0.407	organonitrogen compound metabolic process
GO:0048583	0.361	regulation of response to stimulus
GO:0042221	0.357	response to chemical
GO:0034641	0.319	cellular nitrogen compound metabolic process
GO:0019538	0.316	protein metabolic process
GO:0045944	0.312	positive regulation of transcription by RNA polymerase II
GO:0046483	0.309	heterocycle metabolic process
GO:0050793	0.306	regulation of developmental process
GO:0006725	0.303	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0005654	0.983	nucleoplasm
GO:0005829	0.976	cytosol
GO:0032991	0.900	protein-containing complex
GO:0140513	0.738	nuclear protein-containing complex
GO:0043232	0.431	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:48096	0.758	L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine
EC:2.1.1.319	0.758	type I protein arginine methyltransferase.
RHEA:48100	0.417	L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine
EC:2.1.1.321	0.417	type III protein arginine methyltransferase.

[back to server]