StarFunc result for job id Q86X60

User Input

>input (149 residues)
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLPSCNNGHFWMFHSQAVYDINRLDSTGV
NILLWGNLPEIEESTDEDVLNISAEECIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0Y354	0.870	0.870	1.352E-23	149	0.966	0.966	H0Y354.pdb.gz	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
2	AFDB:A1KXW8	0.874	0.874	2.489E-23	149	0.886	0.886	A1KXW8.pdb.gz	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
3	AFDB:A0A087WSW5	0.423	0.648	4.194E-10	94	0.510	0.809	A0A087WSW5.pdb.gz	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
4	AFDB:Q9P802	0.525	0.415	2.034E-4	194	0.121	0.093	Q9P802.pdb.gz	MIS18_SCHPO Kinetochore protein mis18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis18 PE=1 SV=2
5	AFDB:Q9CZJ6	0.479	0.362	5.223E-4	204	0.148	0.108	Q9CZJ6.pdb.gz	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
6	AFDB:P62699	0.489	0.587	1.269E-3	121	0.081	0.099	P62699.pdb.gz	YPEL5_HUMAN Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1
7	AFDB:Q2V3E2	0.460	0.619	1.269E-3	105	0.128	0.181	Q2V3E2.pdb.gz	YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana OX=3702 GN=At4g27740 PE=3 SV=1
8	AFDB:A2AQ14	0.495	0.326	1.584E-3	241	0.161	0.100	A2AQ14.pdb.gz	MS18B_MOUSE Protein Mis18-beta OS=Mus musculus OX=10090 GN=Oip5 PE=2 SV=1
9	AFDB:A0A024R9N0	0.459	0.316	1.675E-3	229	0.154	0.100	A0A024R9N0.pdb.gz
10	AFDB:Q9XZF0	0.488	0.586	1.871E-3	121	0.081	0.099	Q9XZF0.pdb.gz	YIPP_DROME Protein yippee OS=Drosophila melanogaster OX=7227 GN=Ype PE=1 SV=1
11	PDB:5fqdE	0.419	0.195	2.911E-3	367	0.134	0.054	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
12	PDB:6h0gB	0.437	0.184	3.077E-3	401	0.148	0.055	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
13	PDB:2kv1A	0.365	0.421	6.329E-3	124	0.114	0.137	2kv1A.pdb.gz
14	PDB:6h61A	0.377	0.100	3.533E-2	660	0.094	0.021	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
15	PDB:6symA	0.382	0.412	1.072E-1	135	0.094	0.104	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
16	PDB:5yzgY	0.144	0.109	4.792E-1	204	0.054	0.039	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:6j6qF	0.146	0.137	4.792E-1	161	0.067	0.062	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:6xywAc	0.122	0.092	1.042	218	0.027	0.018	6xywAc.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
19	PDB:1x0tA	0.164	0.216	1.375	106	0.074	0.104	1x0tA.pdb.gz	Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
20	PDB:7abzC	0.124	0.095	1.716	209	0.013	0.010	7abzC.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86X60	1.45e-108	306	149	1.000	1.000	FA72B_HUMAN Protein FAM72B OS=Homo sapiens OX=9606 GN=FAM72B PE=1 SV=2
2	Q5TYM5	4.55e-107	303	149	0.987	0.987	FA72A_HUMAN Protein FAM72A OS=Homo sapiens OX=9606 GN=FAM72A PE=1 SV=1
3	Q6L9T8	3.93e-104	295	149	0.973	0.973	FA72D_HUMAN Protein FAM72D OS=Homo sapiens OX=9606 GN=FAM72D PE=1 SV=1
4	H0Y354	3.27e-103	293	149	0.966	0.966	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
5	A1KXW8	2.39e-94	271	149	0.886	0.886	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
6	A0A087WSW5	1.30e-48	153	94	0.510	0.809	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
7	A0A087WZP4	1.77e-48	153	94	0.510	0.809	A0A087WZP4_HUMAN Family with sequence similarity 72 member B OS=Homo sapiens OX=9606 GN=FAM72B PE=3 SV=1
8	Q8IAM0	1.8	30.8	1397	0.107	0.011	Q8IAM0_PLAF7 Glutamate dehydrogenase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802000 PE=3 SV=1
9	Q96DY7	2.1	30.8	904	0.141	0.023	MTBP_HUMAN Mdm2-binding protein OS=Homo sapiens OX=9606 GN=MTBP PE=1 SV=1
10	Q1ECF1	7.0	28.9	211	0.101	0.071	PYL7_ARATH Abscisic acid receptor PYL7 OS=Arabidopsis thaliana OX=3702 GN=PYL7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14976 FAM72	2.2e-74	259.9	FAM72 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358397

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414891	0.608	Protein GVQW1
2	9606.ENSP00000477695	0.596	Ankyrin repeat domain-containing protein 20A1
3	9606.ENSP00000349891	0.564	Ankyrin repeat domain-containing protein 20A4
4	9606.ENSP00000366826	0.561	Ankyrin repeat domain-containing protein 20A2
5	9606.ENSP00000481934	0.559	Rho GTPase-activating protein 11B
6	9606.ENSP00000362146	0.542	Borealin
7	9606.ENSP00000358813	0.541	Dual specificity protein kinase TTK
8	9606.ENSP00000366608	0.532	COBW domain-containing protein 6
9	9606.ENSP00000445905	0.518	EVI5-like protein
10	9606.ENSP00000395232	0.517	Mitochondrial fission regulator 2
11	9606.ENSP00000265036	0.515	DEP domain containing 1B
12	9606.ENSP00000331298	0.504	UBA-like domain-containing protein 2
13	9606.ENSP00000380866	0.504	Zinc finger family member 788
14	9606.ENSP00000373827	0.502	Coiled-coil domain containing 150

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009966	0.974	regulation of signal transduction
GO:0048523	0.970	negative regulation of cellular process
GO:0065009	0.966	regulation of molecular function
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0080090	0.963	regulation of primary metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0048522	0.949	positive regulation of cellular process
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0051338	0.920	regulation of transferase activity
GO:0031399	0.909	regulation of protein modification process
GO:0019220	0.830	regulation of phosphate metabolic process
GO:0051348	0.829	negative regulation of transferase activity
GO:0031400	0.826	negative regulation of protein modification process
GO:0045859	0.821	regulation of protein kinase activity
GO:0006469	0.787	negative regulation of protein kinase activity
GO:0010941	0.763	regulation of cell death
GO:0010469	0.759	regulation of signaling receptor activity
GO:0050732	0.759	negative regulation of peptidyl-tyrosine phosphorylation
GO:0061097	0.757	regulation of protein tyrosine kinase activity
GO:0009987	0.712	cellular process
GO:0043067	0.703	regulation of programmed cell death
GO:0010942	0.677	positive regulation of cell death
GO:0023057	0.656	negative regulation of signaling
GO:0010648	0.636	negative regulation of cell communication
GO:0042981	0.633	regulation of apoptotic process
GO:0048585	0.616	negative regulation of response to stimulus
GO:0043068	0.614	positive regulation of programmed cell death
GO:0009968	0.597	negative regulation of signal transduction
GO:0043065	0.590	positive regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.521	nucleus
GO:0043232	0.498	intracellular non-membrane-bounded organelle
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]