StarFunc result for job id Q86X67

User Input

>input (352 residues)
MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQ
TSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISA
SLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNV
AGSKRVCPSNNIIYYPQMAPVAITLVSDGTRCLLARQSSFPKGMYSALAGFCDIGESVEE
TIRREVAEEVGLEVESLQYYASQHWPFPSGSLMIACHATVKPGQTEIQVNLRELETAAWF
SHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSLPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86X67	1.000	1.000	1.099E-77	352	1.000	1.000	Q86X67.pdb.gz	NUD13_HUMAN NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT13 PE=2 SV=3
2	AFDB:Q8JZU0	0.935	0.935	6.992E-65	352	0.778	0.778	Q8JZU0.pdb.gz	NUD13_MOUSE NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Mus musculus OX=10090 GN=Nudt13 PE=1 SV=2
3	AFDB:Q94A82	0.740	0.601	1.336E-28	438	0.310	0.249	Q94A82.pdb.gz	NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT19 PE=1 SV=1
4	AFDB:Q9BQG2	0.732	0.566	2.143E-28	462	0.318	0.242	Q9BQG2.pdb.gz	NUD12_HUMAN NAD-capped RNA hydrolase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12 PE=1 SV=1
5	AFDB:Q9DCN1	0.724	0.559	5.516E-28	462	0.310	0.236	Q9DCN1.pdb.gz	NUD12_MOUSE NAD-capped RNA hydrolase NUDT12 OS=Mus musculus OX=10090 GN=Nudt12 PE=1 SV=1
6	AFDB:P9WIX5	0.702	0.783	4.362E-27	313	0.270	0.304	P9WIX5.pdb.gz	NUDC_MYCTU NAD-capped RNA hydrolase NudC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nudC PE=3 SV=1
7	AFDB:Q9Y7J0	0.724	0.680	6.998E-27	376	0.293	0.274	Q9Y7J0.pdb.gz	NPY1_SCHPO NAD-capped RNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.03c PE=3 SV=1
8	AFDB:Q5AU26	0.770	0.658	4.125E-25	415	0.278	0.236	Q5AU26.pdb.gz	Q5AU26_EMENI NAD(+) diphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08204 PE=4 SV=1
9	AFDB:P53164	0.737	0.681	4.138E-23	384	0.259	0.237	P53164.pdb.gz	NPY1_YEAST NAD-capped RNA hydrolase NPY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPY1 PE=1 SV=1
10	AFDB:O86062	0.616	0.771	6.649E-22	278	0.230	0.291	O86062.pdb.gz	NUDC_PSEAE NAD-capped RNA hydrolase NudC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nudC PE=3 SV=2
11	PDB:2gb5A	0.609	0.792	1.053E-20	265	0.196	0.260	2gb5A.pdb.gz	Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution
12	PDB:5gp0I	0.275	0.662	1.443E-8	139	0.082	0.209	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
13	PDB:2rrkA	0.312	0.696	6.318E-8	140	0.097	0.243	2rrkA.pdb.gz
14	PDB:4zbpB	0.317	0.401	1.075E-7	270	0.074	0.096	4zbpB.pdb.gz	Crystal Structures of Arabidopsis thaliana Nudix Hydrolase NUDT7 Reveal a Previously Unobserved Conformation.
15	PDB:1vc8A	0.301	0.753	2.060E-7	126	0.094	0.262	1vc8A.pdb.gz	Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate
16	PDB:7b66A	0.273	0.564	2.609E-7	161	0.062	0.137	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.
17	PDB:4hfqA	0.284	0.459	3.505E-7	203	0.085	0.148	4hfqA.pdb.gz
18	PDB:3ffuA	0.268	0.628	5.300E-7	133	0.060	0.158	3ffuA.pdb.gz	Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
19	PDB:2fkbC	0.296	0.562	5.965E-7	167	0.077	0.162	2fkbC.pdb.gz
20	PDB:1ktgA	0.306	0.705	8.015E-7	137	0.065	0.168	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86X67	0.0	731	352	1.000	1.000	NUD13_HUMAN NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT13 PE=2 SV=3
2	Q8JZU0	0.0	565	352	0.778	0.778	NUD13_MOUSE NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Mus musculus OX=10090 GN=Nudt13 PE=1 SV=2
3	Q9BQG2	2.22e-47	168	462	0.312	0.238	NUD12_HUMAN NAD-capped RNA hydrolase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12 PE=1 SV=1
4	Q9DCN1	2.37e-46	166	462	0.261	0.199	NUD12_MOUSE NAD-capped RNA hydrolase NUDT12 OS=Mus musculus OX=10090 GN=Nudt12 PE=1 SV=1
5	P9WIX5	9.83e-40	144	313	0.239	0.268	NUDC_MYCTU NAD-capped RNA hydrolase NudC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nudC PE=3 SV=1
6	Q9Y7J0	3.00e-33	129	376	0.233	0.218	NPY1_SCHPO NAD-capped RNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.03c PE=3 SV=1
7	Q94A82	1.39e-31	125	438	0.307	0.247	NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT19 PE=1 SV=1
8	Q5AU26	2.40e-28	116	415	0.287	0.243	Q5AU26_EMENI NAD(+) diphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08204 PE=4 SV=1
9	P32664	9.88e-24	100	257	0.162	0.222	NUDC_ECOLI NAD-capped RNA hydrolase NudC OS=Escherichia coli (strain K12) OX=83333 GN=nudC PE=1 SV=2
10	O86062	1.48e-21	94.7	278	0.202	0.255	NUDC_PSEAE NAD-capped RNA hydrolase NudC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nudC PE=3 SV=2
11	P53164	9.97e-21	94.4	384	0.199	0.182	NPY1_YEAST NAD-capped RNA hydrolase NPY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPY1 PE=1 SV=1
12	Q9CA40	4.07e-04	42.4	147	0.097	0.231	NUDT1_ARATH Nudix hydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=NUDT1 PE=1 SV=1
13	Q7ZWC3	4.30e-04	42.7	156	0.062	0.141	8ODP_DANRE Oxidized purine nucleoside triphosphate hydrolase OS=Danio rerio OX=7955 GN=nudt1 PE=1 SV=1
14	P93740	0.001	42.7	280	0.082	0.104	NUD23_ARATH Nudix hydrolase 23, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT23 PE=1 SV=2
15	P36639	0.009	38.5	156	0.077	0.173	8ODP_HUMAN Oxidized purine nucleoside triphosphate hydrolase OS=Homo sapiens OX=9606 GN=NUDT1 PE=1 SV=4
16	P53369	0.015	38.1	156	0.060	0.135	8ODP_RAT Oxidized purine nucleoside triphosphate hydrolase OS=Rattus norvegicus OX=10116 GN=Nudt1 PE=1 SV=1
17	P53368	0.017	37.7	156	0.060	0.135	8ODP_MOUSE Oxidized purine nucleoside triphosphate hydrolase OS=Mus musculus OX=10090 GN=Nudt1 PE=1 SV=1
18	Q6NPD7	0.054	37.4	277	0.071	0.090	NUD10_ARATH Nudix hydrolase 10 OS=Arabidopsis thaliana OX=3702 GN=NUDT10 PE=1 SV=1
19	Q9RY71	0.15	35.4	171	0.043	0.088	Y079_DEIRA Nudix hydrolase DR_0079 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_0079 PE=1 SV=1
20	Q94B74	0.18	35.8	278	0.071	0.090	NUDT2_ARATH Nudix hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=NUDT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	9.8e-12	56.5	NUDIX domain
2	PF09296 NUDIX-like	9.3e-13	60.1	NADH pyrophosphatase-like rudimentary NUDIX domain
3	PF09297 zf-NADH-PPase	2.6e-08	44.7	NADH pyrophosphatase zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349874

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419628	0.789	ADP-sugar pyrophosphatase
2	9606.ENSP00000380241	0.735	7,8-dihydro-8-oxoguanine triphosphatase
3	9606.ENSP00000425048	0.710	DTW domain containing 2
4	9606.ENSP00000268533	0.702	Peroxisomal coenzyme A diphosphatase NUDT7
5	9606.ENSP00000365883	0.662	Nucleoside diphosphate-linked moiety X motif 8
6	9606.ENSP00000258662	0.648	Nucleotide triphosphate diphosphatase NUDT15
7	9606.ENSP00000476119	0.638	Diphosphoinositol polyphosphate phosphohydrolase 1
8	9606.ENSP00000306670	0.604	Tudor-interacting repair regulator protein
9	9606.ENSP00000279206	0.596	Nucleoside diphosphate-linked moiety X motif 22
10	9606.ENSP00000364498	0.554	Decapping and exoribonuclease protein
11	9606.ENSP00000368455	0.544	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
12	9606.ENSP00000263256	0.539	Desumoylating isopeptidase 1
13	9606.ENSP00000353491	0.527	Zinc finger protein 460
14	9606.ENSP00000334437	0.521	Nucleoside diphosphate-linked moiety X motif 17
15	9606.ENSP00000480722	0.511	8-oxo-dGDP phosphatase NUDT18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	0.999	pyrophosphatase activity
GO:0004551	0.683	dinucleotide phosphatase activity
GO:0005488	0.603	binding
GO:0043167	0.408	ion binding
GO:0005515	0.392	protein binding
GO:0000287	0.367	magnesium ion binding
GO:0035529	0.303	NADH pyrophosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0055086	0.992	nucleobase-containing small molecule metabolic process
GO:1901575	0.571	organic substance catabolic process
GO:0044248	0.569	cellular catabolic process
GO:0044270	0.553	cellular nitrogen compound catabolic process
GO:0046700	0.552	heterocycle catabolic process
GO:0019439	0.543	aromatic compound catabolic process
GO:0034655	0.526	nucleobase-containing compound catabolic process
GO:1901564	0.425	organonitrogen compound metabolic process
GO:0009117	0.377	nucleotide metabolic process
GO:0072521	0.368	purine-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.994	intracellular organelle lumen
GO:0005759	0.541	mitochondrial matrix
GO:0005829	0.359	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.999	In phosphorus-containing anhydrides.
RHEA:48868	0.303	H2O + NADH = AMP + 2 H(+) + reduced beta-nicotinamide D-ribonucleotide
EC:3.6.1.22	0.303	NAD(+) diphosphatase.

[back to server]