StarFunc result for job id Q86XA0

User Input

>input (190 residues)
MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILSDSSELPHCLE
VCRQSCQMNNLPHLQVVGLTWGHISWDLLALPPQDIILASDVFFEPEDFEDILATIYFLM
HKNPKVQLWSTYQVRSADWSLEALLYKWDMKCVHIPLESFDADKEDIAESTLPGRHTVEM
LVISFAKDSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XA0	1.000	1.000	1.310E-42	190	1.000	1.000	Q86XA0.pdb.gz	MET23_HUMAN Histone-arginine methyltransferase METTL23 OS=Homo sapiens OX=9606 GN=METTL23 PE=1 SV=3
2	AFDB:A2AA28	0.996	0.748	1.057E-38	253	0.895	0.672	A2AA28.pdb.gz	MET23_MOUSE Histone-arginine methyltransferase METTL23 OS=Mus musculus OX=10090 GN=Mettl23 PE=1 SV=1
3	AFDB:Q8C436	0.749	0.631	1.649E-12	228	0.268	0.224	Q8C436.pdb.gz	MT21D_MOUSE Protein N-lysine methyltransferase METTL21D OS=Mus musculus OX=10090 GN=Vcpkmt PE=1 SV=2
4	AFDB:Q9H867	0.750	0.629	4.334E-12	229	0.247	0.205	Q9H867.pdb.gz	MT21D_HUMAN Protein N-lysine methyltransferase METTL21D OS=Homo sapiens OX=9606 GN=VCPKMT PE=1 SV=2
5	PDB:4lg1A	0.743	0.655	7.938E-12	217	0.253	0.221	4lg1A.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
6	PDB:4lecA	0.742	0.701	2.353E-11	202	0.284	0.267	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
7	AFDB:Q96AZ1	0.739	0.629	4.297E-11	226	0.242	0.204	Q96AZ1.pdb.gz	EFMT3_HUMAN EEF1A lysine methyltransferase 3 OS=Homo sapiens OX=9606 GN=EEF1AKMT3 PE=1 SV=1
8	AFDB:Q9UT28	0.734	0.557	8.868E-11	255	0.211	0.157	Q9UT28.pdb.gz	EFM7_SCHPO Protein N-terminal and lysine N-methyltransferase efm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nnt1 PE=3 SV=1
9	AFDB:Q5VZV1	0.725	0.534	1.001E-10	264	0.279	0.201	Q5VZV1.pdb.gz	MT21C_HUMAN Protein-lysine methyltransferase METTL21C OS=Homo sapiens OX=9606 GN=METTL21C PE=1 SV=1
10	AFDB:Q8WXB1	0.746	0.655	1.353E-10	218	0.268	0.234	Q8WXB1.pdb.gz	MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens OX=9606 GN=METTL21A PE=1 SV=2
11	PDB:4qpnA	0.743	0.698	1.355E-10	203	0.237	0.222	4qpnA.pdb.gz	Crystal Structure of Human Methyltransferase-Like Protein 21B
12	AFDB:D3YWP0	0.737	0.612	1.527E-10	232	0.221	0.181	D3YWP0.pdb.gz	EFMT3_MOUSE EEF1A lysine methyltransferase 3 OS=Mus musculus OX=10090 GN=Eef1akmt3 PE=3 SV=1
13	AFDB:P0C5J1	0.781	0.468	2.193E-10	330	0.195	0.112	P0C5J1.pdb.gz	F86B2_HUMAN Putative protein N-methyltransferase FAM86B2 OS=Homo sapiens OX=9606 GN=FAM86B2 PE=1 SV=1
14	PDB:4mtlB	0.715	0.627	3.352E-10	219	0.274	0.237	4mtlB.pdb.gz	Human Methyltransferase-Like Protein 21C
15	PDB:3v97A	0.626	0.207	1.802E-8	667	0.168	0.048	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
16	PDB:3v97B	0.624	0.213	2.160E-8	641	0.179	0.053	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
17	PDB:6h2vA	0.619	0.567	3.951E-8	210	0.153	0.138	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
18	PDB:6yxxE4	0.550	0.275	8.660E-8	434	0.158	0.069	6yxxE4.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:2bh2A	0.552	0.277	1.244E-7	418	0.132	0.060	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
20	PDB:1jsxA	0.552	0.545	1.491E-7	193	0.158	0.155	1jsxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XA0	1.54e-140	391	190	1.000	1.000	MET23_HUMAN Histone-arginine methyltransferase METTL23 OS=Homo sapiens OX=9606 GN=METTL23 PE=1 SV=3
2	A2AA28	2.15e-129	365	253	0.895	0.672	MET23_MOUSE Histone-arginine methyltransferase METTL23 OS=Mus musculus OX=10090 GN=Mettl23 PE=1 SV=1
3	Q8WXB1	2.40e-15	73.2	218	0.289	0.252	MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens OX=9606 GN=METTL21A PE=1 SV=2
4	Q8BLU2	3.02e-09	57.0	248	0.279	0.214	MT21C_MOUSE Protein-lysine methyltransferase METTL21C OS=Mus musculus OX=10090 GN=Mettl21c PE=2 SV=1
5	D3YWP0	3.35e-09	56.6	232	0.258	0.211	EFMT3_MOUSE EEF1A lysine methyltransferase 3 OS=Mus musculus OX=10090 GN=Eef1akmt3 PE=3 SV=1
6	Q9H867	7.33e-09	55.5	229	0.279	0.231	MT21D_HUMAN Protein N-lysine methyltransferase METTL21D OS=Homo sapiens OX=9606 GN=VCPKMT PE=1 SV=2
7	Q96AZ1	1.33e-08	54.7	226	0.221	0.186	EFMT3_HUMAN EEF1A lysine methyltransferase 3 OS=Homo sapiens OX=9606 GN=EEF1AKMT3 PE=1 SV=1
8	Q8C436	1.55e-08	54.7	228	0.284	0.237	MT21D_MOUSE Protein N-lysine methyltransferase METTL21D OS=Mus musculus OX=10090 GN=Vcpkmt PE=1 SV=2
9	Q5VZV1	9.51e-08	52.8	264	0.274	0.197	MT21C_HUMAN Protein-lysine methyltransferase METTL21C OS=Homo sapiens OX=9606 GN=METTL21C PE=1 SV=1
10	F4JNX3	5.28e-07	50.8	304	0.247	0.155	CMKMT_ARATH Calmodulin-lysine N-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=CaMKMT PE=2 SV=1
11	Q05874	5.36e-06	47.8	261	0.168	0.123	EFM7_YEAST Protein N-terminal and lysine N-methyltransferase EFM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNT1 PE=1 SV=1
12	Q9UT28	1.51e-05	46.2	255	0.163	0.122	EFM7_SCHPO Protein N-terminal and lysine N-methyltransferase efm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nnt1 PE=3 SV=1
13	H3BTF5	1.35e-04	43.9	348	0.242	0.132	H3BTF5_HUMAN Methyltransferase 22, Kin17 lysine OS=Homo sapiens OX=9606 GN=METTL22 PE=1 SV=1
14	Q9BUU2	1.79e-04	43.5	404	0.242	0.114	MET22_HUMAN Methyltransferase-like protein 22 OS=Homo sapiens OX=9606 GN=METTL22 PE=1 SV=2
15	O13926	0.001	40.8	327	0.216	0.125	YF66_SCHPO UPF0665 family protein C23C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23C4.06c PE=3 SV=1
16	Q582G4	0.002	40.4	390	0.153	0.074	ANM7_TRYB2 Protein arginine N-methyltransferase 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PRMT7 PE=1 SV=1
17	O95568	0.004	39.3	372	0.189	0.097	MET18_HUMAN Histidine protein methyltransferase 1 homolog OS=Homo sapiens OX=9606 GN=METTL18 PE=1 SV=1
18	Q8IXQ9	0.010	38.1	262	0.205	0.149	ETKMT_HUMAN Electron transfer flavoprotein beta subunit lysine methyltransferase OS=Homo sapiens OX=9606 GN=ETFBKMT PE=1 SV=1
19	B3DIQ7	0.013	37.7	357	0.100	0.053	B3DIQ7_DANRE Methyltransferase 22, Kin17 lysine OS=Danio rerio OX=7955 GN=mettl22 PE=2 SV=1
20	P87241	0.014	37.7	405	0.179	0.084	RIB2_SCHPO Diaminohydroxyphosphoribosylamino-pyrimidine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rib2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10294 Methyltransf_16	2.4e-13	61.7	Lysine methyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348050	0.808	Matrix-remodeling-associated protein 7
2	9606.ENSP00000307975	0.796	Histidine protein methyltransferase 1 homolog
3	9606.ENSP00000371345	0.785	Methyltransferase-like protein 22
4	9606.ENSP00000350353	0.718	Electron transfer flavoprotein beta subunit lysine methyltransferase
5	9606.ENSP00000398502	0.714	Protein-lysine N-methyltransferase EEF2KMT
6	9606.ENSP00000372206	0.704	EEF1A lysine methyltransferase 1
7	9606.ENSP00000368881	0.701	DNA/RNA-binding protein KIN17
8	9606.ENSP00000346886	0.698	GA-binding protein alpha chain
9	9606.ENSP00000454380	0.687	Protein FAM173A
10	9606.ENSP00000414624	0.644	Phosphoribosyl pyrophosphate synthase-associated protein 1
11	9606.ENSP00000422338	0.643	Protein FAM173B
12	9606.ENSP00000357829	0.611	EEF1A lysine methyltransferase 2
13	9606.ENSP00000322775	0.570	Inactive rhomboid protein 2
14	9606.ENSP00000354920	0.555	Methyltransferase-like protein 13
15	9606.ENSP00000356567	0.534	Acyl-CoA-binding domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031072	0.999	heat shock protein binding
GO:0008757	0.998	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	0.997	N-methyltransferase activity
GO:0008276	0.996	protein methyltransferase activity
GO:0140297	0.990	DNA-binding transcription factor binding
GO:0016279	0.539	protein-lysine N-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.978	regulation of primary metabolic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0010468	0.968	regulation of gene expression
GO:0010556	0.966	regulation of macromolecule biosynthetic process
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.962	positive regulation of cellular process
GO:0051173	0.898	positive regulation of nitrogen compound metabolic process
GO:0051252	0.897	regulation of RNA metabolic process
GO:0009891	0.892	positive regulation of biosynthetic process
GO:0010604	0.891	positive regulation of macromolecule metabolic process
GO:0009987	0.888	cellular process
GO:0031325	0.879	positive regulation of cellular metabolic process
GO:0006355	0.877	regulation of DNA-templated transcription
GO:0008152	0.867	metabolic process
GO:0071704	0.860	organic substance metabolic process
GO:0044237	0.847	cellular metabolic process
GO:0044238	0.845	primary metabolic process
GO:0010557	0.840	positive regulation of macromolecule biosynthetic process
GO:0031328	0.833	positive regulation of cellular biosynthetic process
GO:0006807	0.831	nitrogen compound metabolic process
GO:0006357	0.826	regulation of transcription by RNA polymerase II
GO:0043170	0.810	macromolecule metabolic process
GO:1901564	0.752	organonitrogen compound metabolic process
GO:0019538	0.737	protein metabolic process
GO:0044260	0.714	cellular macromolecule metabolic process
GO:0003008	0.703	system process
GO:0045893	0.665	positive regulation of DNA-templated transcription
GO:0036211	0.561	protein modification process
GO:0050877	0.550	nervous system process
GO:0032259	0.537	methylation
GO:0050890	0.512	cognition
GO:0006479	0.508	protein methylation
GO:0045944	0.443	positive regulation of transcription by RNA polymerase II
GO:0018193	0.389	peptidyl-amino acid modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0032991	0.972	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.997	Methyltransferases.
RHEA:51736	0.539	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]