StarFunc result for job id Q86XA9

User Input

>input (2040 residues)
MELAHSLLLNEEAYNQLGEVQKAEFIFEWLRYLEKLLLATSRNDVREKQKTLVEQLLSLL
NSSPGPPTRKLLAKNLAILYSIGDTFSVHEAIDKCNDLIRSKDDSPSYLPTKLAAVVCLG
SLYKKLGRILGNTFTDTVGNILKAMKSAESQGRYEIMLSLQNILNGLGAAAAPCHRDVYK
AARSCLTDRSMAVRCAAAKNEAIFMWSTDLDSVATLCFKSFEGSNYDVRISVSKLLGIIL
AKAVISKHPGTAASRQSIRRVSLEEVLELLGTGFLRGSSGFLRASGDMLKGTSSVSRDVR
VGVTQAYVVFVSTLGGAWLEKNFAAFFSHILSLASPSHPKATQTQIDAVCCRRCVSFILR
TTIGGLLGEKAQLAAVKDICQAIWKLKKVMDAVMSDGNLETRLGSTDVAASQHMLVCALQ
ELGNLIHNLGTTAAPLLQDSSTGLLDSILSVILHPSISVRLAAAWCLHCIAVALPSYLTP
LLDRCLERLTGHKSSPEAVTGFSFAVAALLGAVKHCPLGIPHGKGKIIMTLAEDLLCSAA
QNSRLSAQRTQAGWLLISALMTLGPAVVSHHLARVLLLWKCVFPASPKDLETEKSRGDSF
TWQVTLEGRAGALCAIKSFVSHCGDLLTEEVTQRLLPPLPCAVDLLTQLSSILKMYGSPL
KTPSVVYRQRLYELLILLPPETYEGNLCAILRELAADLTAPDIQVAASTFLLPPLCHQDD
LLILSPFLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEKDVEGDSVPKPLPPALSVIS
SASKLFGVVCAHVGETQRLLILEQLLDSIKHTKGARQQVVQLHVVSSVSSFLKYVAGSKG
CLGPEEMKRFALTLVMGALESPNPLLRCAAAESWARLAQVVDDGAFTAGLAQVSFDKLKS
ARDVVTRTGHSLALGSLHRYLGGISSSQHLNSCIGILYTLAQDSTSPDVQTWALHSLSLI
IDSAGPLYYVHVEPTLSLIIMLLLNVPPTHAEVHQSLGRCLNALITTLGPELQGNSTSIS
TLRTSCLLGCAVMQDNPDCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLL
RRAVLACLRQLVQREAAEVSEHAVMLAKDSREELTPDANIREVGLEGALLILLDKETDER
LCHDIKETLNYMLTSMAVEKLSLWLKLCKDVLAASADFTAVTCVDTMQEEEGDKGDDASV
LTTRRDEKSHPFTNPRWATRVFAAECVCRIINQCENANSAHFDIALAQEMKKRDSRNDFL
VLHLADLIRMAFMAATDHSDQLRLSGLEMLLVVIRRFATVPEPEFPGHVILEQYQANVGA
ALRPAFTSETPPDVTAKACQVCSAWIASGVVSDLNDLRRVHQLLVSSLTKIQAGKEALSH
LYNESASTMEILAVLKAWAEVYIIAVQRHKNHRQPLKTTTCLEDGIRNGSCSSDGLLDLV
YADLGTLSRLWLAALQDFALLTLPSEFASQLPAEGGAFYTAETSENAKLHYYNSWALILH
ATALWLTSTGFVVADPDEGASNLSRPVTPTSMCQGSSSGATIKSPEDVYTDRFHLILGIS
VEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQDLGIELLNVLHRVILTRESP
SIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGAAEKETLPEFGEGKDTGGLVPGKSLVF
ATLELCVCILVRQLPELNPKLTGSPGVKATKPQILLEDGSRLVSAALVILSELPAVCSPE
GSISILPTILYLTIGVLRETAVKLPGGQLSSTVAASLQALKGILSSPMARAEKSRTAWTD
LLRSALTTILDCWDPVDETHQELDEVSLLTAITVFILSTSPEVTTIPCLQKRCIDKFKAT
LEIKDPVVQIKTYQLLHSIFQYPNPAVSYPYIYSLASCIMEKLQEIDKRKPENTAELEIF
QEGIKVLETLVTVAEEHHRAQLVACLLPILISFLLDENSLGSATSIMRNLHDFALQNLMQ
IGPQYSSVFKSLVASSPALKARLEAAIKGNQESVKVKIPTSKYTKSPGKNSSIQLKTSFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XA9	1.000	1.000	0.000	2040	1.000	1.000	Q86XA9.pdb.gz	HTR5A_HUMAN HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2
2	AFDB:Q9P2D3	0.949	0.935	0.000	2071	0.587	0.578	Q9P2D3.pdb.gz	HTR5B_HUMAN HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2
3	AFDB:O01485	0.875	0.860	1.781E-103	2076	0.357	0.351	O01485.pdb.gz	O01485_CAEEL HEAT repeat-containing protein 5B OS=Caenorhabditis elegans OX=6239 GN=soap-1 PE=1 SV=1
4	AFDB:F4HRS2	0.672	0.621	4.331E-53	2222	0.213	0.195	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
5	AFDB:O42998	0.740	0.782	6.679E-43	1919	0.162	0.172	O42998.pdb.gz	SIP1_SCHPO Pof6 interactor protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sip1 PE=1 SV=1
6	AFDB:P39526	0.729	0.737	1.773E-33	2014	0.155	0.157	P39526.pdb.gz	LAA1_YEAST AP-1 accessory protein LAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAA1 PE=1 SV=1
7	AFDB:Q10105	0.168	0.135	8.332E-14	2670	0.130	0.100	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
8	AFDB:Q9VEZ3	0.132	0.132	1.305E-13	2042	0.124	0.123	Q9VEZ3.pdb.gz	MSPS_DROME Protein mini spindles OS=Drosophila melanogaster OX=7227 GN=msps PE=1 SV=3
9	AFDB:A0A1D8PHX3	0.175	0.150	3.199E-13	2482	0.128	0.106	A0A1D8PHX3.pdb.gz	A0A1D8PHX3_CANAL Serine/threonine-protein kinase TOR OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOR1 PE=3 SV=1
10	AFDB:E9PVA8	0.128	0.106	3.311E-13	2671	0.148	0.113	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
11	PDB:6bcuA	0.146	0.137	7.398E-12	2204	0.126	0.117	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
12	PDB:6x9oA	0.192	0.173	3.875E-11	2425	0.156	0.131	6x9oA.pdb.gz
13	PDB:6zwmB	0.127	0.120	4.152E-11	2185	0.129	0.120	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
14	PDB:7mqaSP	0.125	0.110	5.286E-11	2485	0.137	0.112	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7tyrA	0.121	0.077	1.210E-10	3905	0.133	0.069	7tyrA.pdb.gz
16	PDB:7mopA	0.130	0.115	1.296E-10	2445	0.125	0.105	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
17	PDB:7mqaLM	0.111	0.111	2.412E-10	2041	0.126	0.126	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7sglA	0.134	0.087	3.178E-10	3852	0.136	0.072	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
19	PDB:6ez8A	0.183	0.167	4.047E-10	2353	0.147	0.127	6ez8A.pdb.gz
20	PDB:6xu2A	0.191	0.306	4.189E-10	1091	0.077	0.145	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O01485	0.0	1127	2076	0.370	0.363	O01485_CAEEL HEAT repeat-containing protein 5B OS=Caenorhabditis elegans OX=6239 GN=soap-1 PE=1 SV=1
2	Q86XA9	0.0	4157	2040	1.000	1.000	HTR5A_HUMAN HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2
3	Q8C547	0.0	2365	2070	0.589	0.581	HTR5B_MOUSE HEAT repeat-containing protein 5B OS=Mus musculus OX=10090 GN=Heatr5b PE=1 SV=3
4	Q9P2D3	0.0	2350	2071	0.590	0.581	HTR5B_HUMAN HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2
5	F4HRS2	2.51e-71	269	2222	0.179	0.165	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
6	O42998	1.55e-18	95.5	1919	0.058	0.062	SIP1_SCHPO Pof6 interactor protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sip1 PE=1 SV=1
7	P39526	3.67e-14	81.3	2014	0.028	0.028	LAA1_YEAST AP-1 accessory protein LAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAA1 PE=1 SV=1
8	P87117	2.7	35.4	464	0.010	0.045	BECN1_SCHPO Vacuolar protein sorting-associated protein atg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg6 PE=3 SV=4
9	Q8H0U4	3.2	35.4	891	0.025	0.056	TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana OX=3702 GN=TRN1 PE=1 SV=1
10	Q9XUB3	3.7	35.0	781	0.013	0.033	REC8_CAEEL Meiotic recombination protein rec-8 OS=Caenorhabditis elegans OX=6239 GN=rec-8 PE=1 SV=1
11	Q38B63	5.2	34.3	614	0.028	0.093	Q38B63_TRYB2 Membrane-associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1640 PE=4 SV=1
12	Q96T76	5.5	34.7	1030	0.011	0.021	MMS19_HUMAN MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2
13	Q3UHC2	6.5	34.3	2014	0.025	0.026	LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Lrrk1 PE=1 SV=1
14	H0Y746	7.0	33.9	598	0.011	0.037	H0Y746_HUMAN MMS19 nucleotide excision repair protein (Fragment) OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=1
15	Q9LF50	8.7	33.5	415	0.014	0.070	MEX1_ARATH Maltose excess protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MEX1 PE=2 SV=2
16	P02919	9.6	33.5	844	0.016	0.038	PBPB_ECOLI Penicillin-binding protein 1B OS=Escherichia coli (strain K12) OX=83333 GN=mrcB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02985 HEAT	1.3	20.5	HEAT repeat
2	PF13646 HEAT_2	0.00082	31.1	HEAT repeats
3	PF20210 Laa1_Sip1_HTR5	3.5e-64	227.5	Laa1/Sip1/HEATR5 HEAT repeat region
4	PF14911 MMS22L_C	10	16.7	S-phase genomic integrity recombination mediator, C-terminal
5	PF04048 Sec8_exocyst	45	15.4	Sec8 exocyst complex component specific domain
6	PF12755 Vac14_Fab1_bd	4	19.5	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377148	0.830	AP-1 complex subunit gamma-1
2	9606.ENSP00000308292	0.653	Protein FAM170B
3	9606.ENSP00000377250	0.648	Protein MON2 homolog
4	9606.ENSP00000261842	0.647	AP-4 complex subunit epsilon-1
5	9606.ENSP00000312442	0.647	AP-1 complex subunit gamma-like 2
6	9606.ENSP00000282251	0.564	CWF19-like protein 2
7	9606.ENSP00000386166	0.560	Proline rich 21
8	9606.ENSP00000411593	0.547	Glycine receptor subunit alpha-1
9	9606.ENSP00000352401	0.531	Ribulose-phosphate 3-epimerase
10	9606.ENSP00000312224	0.518	Putative D-tyrosyl-tRNA(Tyr) deacylase 2
11	9606.ENSP00000395204	0.507	Transmembrane protein 68
12	9606.ENSP00000329995	0.504	Protein FAM186A
13	9606.ENSP00000350358	0.504	PRAME family member 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.974	localization
GO:0051641	0.889	cellular localization
GO:0032502	0.764	developmental process
GO:0070727	0.747	cellular macromolecule localization
GO:0008104	0.741	protein localization
GO:0048856	0.338	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0016604	0.984	nuclear body
GO:0012505	0.959	endomembrane system
GO:0016607	0.941	nuclear speck
GO:0031982	0.822	vesicle
GO:0097708	0.751	intracellular vesicle
GO:0031410	0.569	cytoplasmic vesicle
GO:0071944	0.508	cell periphery
GO:0005886	0.440	plasma membrane
GO:0032991	0.345	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]