StarFunc result for job id Q86XE3

User Input

>input (530 residues)
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRR
RRRWGELSVAAAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP
VAAAKETVAIGRTDIEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVA
KTWKSLSKQELNQMLAETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGFRIA
FNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKT
DAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKKGKAELNFEDF
YRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG
ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFK
IFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XE3	1.000	1.000	5.573E-80	530	1.000	1.000	Q86XE3.pdb.gz	MICU3_HUMAN Calcium uptake protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=MICU3 PE=1 SV=1
2	AFDB:Q8CD10	0.555	0.675	5.322E-28	432	0.321	0.394	Q8CD10.pdb.gz	MICU2_MOUSE Calcium uptake protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Micu2 PE=1 SV=2
3	AFDB:Q8IYU8	0.534	0.647	2.002E-27	434	0.308	0.376	Q8IYU8.pdb.gz	MICU2_HUMAN Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2
4	PDB:6iihA	0.506	0.598	1.275E-22	446	0.266	0.316	6iihA.pdb.gz	The crystal structure of MICU2 provides insight into Ca2+binding and MICU1-MICU2 heterodimer formation.
5	AFDB:A2VEI2	0.447	0.451	9.444E-19	525	0.234	0.236	A2VEI2.pdb.gz	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
6	AFDB:A0A286YF11	0.456	0.497	4.799E-17	482	0.211	0.232	A0A286YF11.pdb.gz	A0A286YF11_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
7	AFDB:Q9SZ45	0.422	0.446	4.232E-16	498	0.183	0.195	Q9SZ45.pdb.gz	MICU_ARATH Calcium uptake protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MICU PE=2 SV=1
8	PDB:6xjxQ	0.445	0.611	7.987E-14	367	0.200	0.289	6xjxQ.pdb.gz
9	AFDB:Q581Z7	0.431	0.542	2.561E-12	410	0.166	0.215	Q581Z7.pdb.gz	Q581Z7_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.270 PE=4 SV=1
10	PDB:6k7yI	0.450	0.753	8.653E-12	306	0.194	0.337	6k7yI.pdb.gz	Structure of intact human MCU supercomplex with the auxiliary MICU subunits.
11	AFDB:Q4QIT3	0.424	0.623	1.900E-10	345	0.132	0.203	Q4QIT3.pdb.gz	Q4QIT3_LEIMA EF-hand domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0110 PE=4 SV=1
12	PDB:1hqvA	0.122	0.303	1.332E-2	178	0.062	0.185	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
13	PDB:1s1eA	0.109	0.275	1.397E-2	181	0.055	0.160	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
14	AFDB:Q9VDY9	0.135	0.160	1.971E-2	418	0.104	0.132	Q9VDY9.pdb.gz	Q9VDY9_DROME GH10101p OS=Drosophila melanogaster OX=7227 GN=myd PE=2 SV=2
15	PDB:7ukhI	0.108	0.263	4.782E-2	181	0.049	0.144	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
16	PDB:4uslA	0.106	0.252	6.982E-2	173	0.042	0.127	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
17	PDB:1ggzA	0.104	0.337	1.069E-1	144	0.049	0.181	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:5a2hA	0.103	0.331	1.292E-1	147	0.049	0.177	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
19	PDB:7eebI	0.120	0.301	1.489E-1	174	0.057	0.172	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
20	AFDB:Q9Y3T9	0.103	0.082	7.905E-1	749	0.126	0.089	Q9Y3T9.pdb.gz	NOC2L_HUMAN Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XE3	0.0	1096	530	1.000	1.000	MICU3_HUMAN Calcium uptake protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=MICU3 PE=1 SV=1
2	Q8CD10	1.64e-92	291	432	0.308	0.377	MICU2_MOUSE Calcium uptake protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Micu2 PE=1 SV=2
3	Q8IYU8	4.02e-90	285	434	0.289	0.353	MICU2_HUMAN Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2
4	Q8VCX5	6.19e-40	153	477	0.198	0.220	MICU1_MOUSE Calcium uptake protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Micu1 PE=1 SV=1
5	Q9BPX6	1.46e-39	152	476	0.196	0.218	MICU1_HUMAN Calcium uptake protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
6	A0A0U1RRK1	1.81e-39	151	480	0.196	0.217	A0A0U1RRK1_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
7	A0A286YF11	6.18e-38	147	482	0.200	0.220	A0A286YF11_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
8	A2VEI2	1.29e-32	133	525	0.194	0.196	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
9	Q9SZ45	2.79e-27	117	498	0.185	0.197	MICU_ARATH Calcium uptake protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MICU PE=2 SV=1
10	Q581Z7	3.91e-10	64.3	410	0.092	0.120	Q581Z7_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.270 PE=4 SV=1
11	Q4QIT3	5.16e-07	54.3	345	0.136	0.209	Q4QIT3_LEIMA EF-hand domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0110 PE=4 SV=1
12	O75746	4.44e-06	52.0	678	0.132	0.103	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
13	Q8BH59	1.61e-05	50.1	677	0.126	0.099	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
14	F1LX07	1.84e-05	50.1	676	0.126	0.099	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
15	P28470	0.005	40.4	176	0.049	0.148	CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus OX=10116 GN=Ppp3r2 PE=2 SV=2
16	Q9QXX4	0.006	41.6	676	0.062	0.049	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
17	Q9NRD9	0.009	41.6	1551	0.060	0.021	DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens OX=9606 GN=DUOX1 PE=1 SV=1
18	Q9UJS0	0.020	40.0	675	0.132	0.104	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
19	Q9VA73	0.032	39.3	695	0.077	0.059	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
20	A0A0S2Z6B0	0.043	36.6	124	0.026	0.113	A0A0S2Z6B0_HUMAN EF-hand domain family member A1 isoform 2 OS=Homo sapiens OX=9606 GN=EFHA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.00035	31.0	EF hand
2	PF12763 EF-hand_4	1.9e+02	13.4	Cytoskeletal-regulatory complex EF hand
3	PF13405 EF-hand_6	1.5e-06	38.6	EF-hand domain
4	PF13499 EF-hand_7	6.5e-08	44.2	EF-hand domain pair
5	PF13833 EF-hand_8	1.1e-08	46.0	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321455

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378145	0.957	Calcium uniporter regulatory subunit MCUb, mitochondrial
2	9606.ENSP00000327467	0.947	Essential MCU regulator, mitochondrial
3	9606.ENSP00000362144	0.946	Calcium uniporter protein, mitochondrial
4	9606.ENSP00000180166	0.922	Fibroblast growth factor 20
5	9606.ENSP00000354415	0.909	Calcium uptake protein 1, mitochondrial
6	9606.ENSP00000368468	0.875	Mitochondrial calcium uniporter regulator 1
7	9606.ENSP00000311760	0.804	Belongs to the TTC9 family
8	9606.ENSP00000371790	0.793	Fibroblast growth factor 9
9	9606.ENSP00000268704	0.720	Paraplegin
10	9606.ENSP00000269143	0.703	AFG3-like protein 2
11	9606.ENSP00000441875	0.687	Prohibitin-2
12	9606.ENSP00000447091	0.686	Mitochondrial sodium/calcium exchanger protein
13	9606.ENSP00000479488	0.662	Prohibitin
14	9606.ENSP00000295079	0.650	m-AAA protease-interacting protein 1, mitochondrial
15	9606.ENSP00000339532	0.615	THUMP domain-containing protein 3
16	9606.ENSP00000242257	0.613	rRNA methyltransferase 2, mitochondrial
17	9606.ENSP00000305653	0.588	Mitochondrial proton/calcium exchanger protein
18	9606.ENSP00000399324	0.570	Fibroblast growth factor 16
19	9606.ENSP00000301454	0.565	Calcium-binding mitochondrial carrier protein SCaMC-3
20	9606.ENSP00000025301	0.549	A-kinase anchor protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0055085	0.983	transmembrane transport
GO:0030001	0.978	metal ion transport
GO:0071702	0.977	organic substance transport
GO:1990542	0.970	mitochondrial transmembrane transport
GO:0050789	0.967	regulation of biological process
GO:0006816	0.965	calcium ion transport
GO:0055074	0.958	calcium ion homeostasis
GO:0098655	0.958	monoatomic cation transmembrane transport
GO:0098662	0.946	inorganic cation transmembrane transport
GO:0070588	0.942	calcium ion transmembrane transport
GO:0006873	0.937	intracellular monoatomic ion homeostasis
GO:0030003	0.930	intracellular monoatomic cation homeostasis
GO:0051560	0.919	mitochondrial calcium ion homeostasis
GO:0047484	0.852	regulation of response to osmotic stress
GO:0050794	0.676	regulation of cellular process
GO:0071840	0.517	cellular component organization or biogenesis
GO:0016043	0.471	cellular component organization
GO:0050896	0.436	response to stimulus
GO:1901000	0.354	regulation of response to salt stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019866	0.995	organelle inner membrane
GO:0031966	0.995	mitochondrial membrane
GO:0005743	0.993	mitochondrial inner membrane
GO:0032991	0.710	protein-containing complex
GO:0098796	0.676	membrane protein complex
GO:1902495	0.328	transmembrane transporter complex
GO:0034702	0.305	ion channel complex
GO:0034703	0.300	cation channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]