StarFunc result for job id Q86XI2

User Input

>input (1143 residues)
MEKRETFVQAVSKELVGEFLQFVQLDKEASDPFSLNELLDELSRKQKEELWQRLKNLLTD
VLLESPVDGWQVVEAQGEDNMETEHGSKMRKSIEIIYAITSVILASVSVINESENYEALL
ECVIILNGILYALPESERKLQSSIQDLCVTWWEKGLPAKEDTGKTAFVMLLRRSLETKTG
ADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFI
KMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKASGKILEAIENDCIQDFMFHGIHLPRRS
PVHSKVREVLSYFHHQKKVRQGVEEMLYRLYKPILWRGLKARNSEVRSNAALLFVEAFPI
RDPNLHAIEMDSEIQKQFEELYSLLEDPYPMVRSTGILGVCKITSKYWEMMPPTILIDLL
KKVTGELAFDTSSADVRCSVFKCLPMILDNKLSHPLLEQLLPALRYSLHDNSEKVRVAFV
DMLLKIKAVRAAKFWKICPMEHILVRLETDSRPVSRRLVSLIFNSFLPVNQPEEVWCERC
VTLVQMNHAAARRFYQYAHEHTACTNIAKLIHVIRHCLNACIQRAVREPPEDEEEEDGRE
KENVTVLDKTLSVNDVACMAGLLEIIVILWKSIDRSMENNKEAKLYTINKFASVLPEYLK
VFKDDRCKIPLFMLMSFMPASAVPPFSCGVISTLRSREEGAVDKSYCTLLDCLCSWGQVG
HILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSA
PRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQHKFCSEG
KVYLSMLEDTGFWLESKILSFIQDQEEDYLKLHRVIYQQIIQTYLTVCKDVVMVGLGDHQ
FQMQLLQRSLGIMQTVKGFFYVSLLLDILKEITGSSLIQKTDSDEEVAMLLDTVQKVFQK
MLECIARSFRKQPEEGLRLLYSVQRPLHEFITAVQSRHTDTPVHRGVLSTLIAGPVVEIS
HQLRKVSDVEELTPPEHLSDLPPFSRCLIGIIIKSSNVVRSFLDELKACVASNDIEGIVC
LTAAVHIILVINAGKHKSSKVREVAATVHRKLKTFMEITLEEDSIERFLYESSSRTLGEL
LNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6DFV1	0.875	0.879	0.000	1138	0.811	0.815	Q6DFV1.pdb.gz	CNDG2_MOUSE Condensin-2 complex subunit G2 OS=Mus musculus OX=10090 GN=Ncapg2 PE=1 SV=2
2	AFDB:Q86XI2	1.000	1.000	0.000	1143	1.000	1.000	Q86XI2.pdb.gz	CNDG2_HUMAN Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1
3	AFDB:F4I8B3	0.569	0.543	3.345E-31	1203	0.199	0.189	F4I8B3.pdb.gz	F4I8B3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HEB1 PE=1 SV=1
4	AFDB:Q20818	0.577	0.641	2.021E-22	1010	0.153	0.173	Q20818.pdb.gz	Q20818_CAEEL CAP-G condensin subunit OS=Caenorhabditis elegans OX=6239 GN=capg-2 PE=1 SV=1
5	AFDB:Q93VS8	0.236	0.241	7.444E-11	1116	0.129	0.133	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
6	AFDB:O74476	0.230	0.237	4.769E-10	1095	0.130	0.136	O74476.pdb.gz	IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sal3 PE=3 SV=1
7	AFDB:Q8I3M5	0.202	0.205	1.145E-9	1123	0.126	0.128	Q8I3M5.pdb.gz	Q8I3M5_PLAF7 Karyopherin beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0524000 PE=4 SV=1
8	AFDB:Q96T76	0.283	0.302	1.228E-9	1030	0.125	0.139	Q96T76.pdb.gz	MMS19_HUMAN MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2
9	PDB:6xu2A	0.225	0.233	1.962E-9	1091	0.124	0.130	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	AFDB:P32337	0.190	0.198	2.006E-9	1089	0.123	0.129	P32337.pdb.gz	IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSE1 PE=1 SV=2
11	AFDB:Q04264	0.194	0.178	2.476E-9	1277	0.136	0.122	Q04264.pdb.gz	PDS5_YEAST Sister chromatid cohesion protein PDS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDS5 PE=1 SV=1
12	PDB:6bcuA	0.196	0.128	1.019E-8	2204	0.133	0.069	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
13	PDB:3w3uA	0.190	0.205	1.983E-8	1030	0.122	0.135	3w3uA.pdb.gz
14	PDB:7owgB	0.184	0.115	2.624E-8	2152	0.142	0.075	7owgB.pdb.gz
15	PDB:7qenD	0.231	0.243	4.138E-8	1050	0.120	0.130	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
16	PDB:7sglA	0.238	0.097	4.761E-8	3852	0.157	0.046	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
17	PDB:1qgkA	0.166	0.198	5.477E-8	876	0.100	0.130	1qgkA.pdb.gz
18	PDB:7q2xD	0.228	0.246	5.477E-8	994	0.117	0.135	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
19	PDB:4a0cA	0.205	0.204	6.301E-8	1155	0.126	0.125	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
20	PDB:7zf1B	0.189	0.186	8.340E-8	1179	0.132	0.128	7zf1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y6U5	0.0	1834	898	0.785	0.999	H0Y6U5_HUMAN Non-SMC condensin II complex subunit G2 (Fragment) OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1
2	Q6DFV1	0.0	1917	1138	0.811	0.815	CNDG2_MOUSE Condensin-2 complex subunit G2 OS=Mus musculus OX=10090 GN=Ncapg2 PE=1 SV=2
3	Q86XI2	0.0	2357	1143	1.000	1.000	CNDG2_HUMAN Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1
4	F4I8B3	1.21e-57	220	1203	0.133	0.126	F4I8B3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HEB1 PE=1 SV=1
5	Q20818	2.79e-18	93.2	1010	0.065	0.073	Q20818_CAEEL CAP-G condensin subunit OS=Caenorhabditis elegans OX=6239 GN=capg-2 PE=1 SV=1
6	Q10105	0.005	43.5	2670	0.045	0.019	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
7	O43005	3.4	34.3	677	0.031	0.052	AP2B_SCHPO AP-2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl1 PE=3 SV=1
8	P42339	6.0	33.5	814	0.023	0.032	PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana OX=3702 GN=VPS34 PE=1 SV=2
9	Q9H9J2	9.3	32.3	332	0.013	0.045	RM44_HUMAN Large ribosomal subunit protein mL44 OS=Homo sapiens OX=9606 GN=MRPL44 PE=1 SV=1
10	Q385T3	9.7	32.7	443	0.021	0.054	Q385T3_TRYB2 J domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2460 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.069	23.4	Adaptin N terminal region
2	PF12717 Cnd1	0.025	26.1	non-SMC mitotic condensation complex subunit 1
3	PF12422 Condensin2nSMC	2.1e-54	195.1	Condensin II non structural maintenance of chromosomes subunit
4	PF02985 HEAT	4.2e-05	34.4	HEAT repeat
5	PF13646 HEAT_2	56	15.6	HEAT repeats

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000001949

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006645	0.998	non-SMC condensin II complex, subunit D3
2	9593.ENSGGOP00000017253	0.993	non-SMC condensin II complex, subunit H2
3	9593.ENSGGOP00000013405	0.984	Structural maintenance of chromosomes 4
4	9593.ENSGGOP00000017290	0.983	Structural maintenance of chromosomes 2
5	9593.ENSGGOP00000010197	0.947	Condensin complex subunit 2
6	9593.ENSGGOP00000009325	0.940	Condensin complex subunit 1
7	9593.ENSGGOP00000017536	0.908	Structural maintenance of chromosomes 3
8	9593.ENSGGOP00000012530	0.894	Serine/threonine-protein kinase PLK
9	9593.ENSGGOP00000027599	0.894	Uncharacterized protein
10	9593.ENSGGOP00000027700	0.894	Uncharacterized protein
11	9593.ENSGGOP00000016204	0.889	Structural maintenance of chromosomes 5
12	9593.ENSGGOP00000012982	0.887	Cyclin-dependent kinase 1
13	9593.ENSGGOP00000014663	0.882	non-SMC condensin I complex, subunit G
14	9593.ENSGGOP00000021751	0.880	Polo-like kinase 4
15	9593.ENSGGOP00000027066	0.879	Cyclin B1
16	9593.ENSGGOP00000012402	0.847	Serine/threonine-protein kinase PLK
17	9593.ENSGGOP00000016054	0.834	RB transcriptional corepressor 1
18	9593.ENSGGOP00000024559	0.831	Probable role in mitotic spindle regulation and coordination of mitotic processes. May have a preferential role in regulating neurogenesis (By similarity)
19	9593.ENSGGOP00000005384	0.820	RB transcriptional corepressor like 1
20	9593.ENSGGOP00000021118	0.820	RB transcriptional corepressor like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.995	histone binding
GO:0140034	0.995	methylation-dependent protein binding
GO:0035064	0.991	methylated histone binding
GO:0140297	0.747	DNA-binding transcription factor binding
GO:0030234	0.726	enzyme regulator activity
GO:0043425	0.566	bHLH transcription factor binding
GO:0004860	0.566	protein kinase inhibitor activity
GO:0030547	0.565	signaling receptor inhibitor activity
GO:0035033	0.554	histone deacetylase regulator activity
GO:0030293	0.554	transmembrane receptor protein tyrosine kinase inhibitor activity
GO:0140677	0.440	molecular function activator activity
GO:0008047	0.420	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0051726	0.950	regulation of cell cycle
GO:0048522	0.925	positive regulation of cellular process
GO:0010564	0.866	regulation of cell cycle process
GO:0071840	0.444	cellular component organization or biogenesis
GO:0045787	0.435	positive regulation of cell cycle
GO:0016043	0.428	cellular component organization
GO:0090068	0.391	positive regulation of cell cycle process
GO:0051983	0.350	regulation of chromosome segregation
GO:0032502	0.332	developmental process
GO:0071704	0.331	organic substance metabolic process
GO:0048856	0.305	anatomical structure development
GO:0007049	0.304	cell cycle
GO:0006996	0.300	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016020	0.966	membrane
GO:0005829	0.928	cytosol
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0016604	0.905	nuclear body
GO:0016607	0.868	nuclear speck
GO:0032991	0.682	protein-containing complex
GO:0005694	0.573	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]