StarFunc result for job id Q86XI6

User Input

>input (285 residues)
MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVK
KRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSAD
YLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYV
KDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKST
QGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XI6	1.000	1.000	3.199E-52	285	1.000	1.000	Q86XI6.pdb.gz	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
2	AFDB:Q6IN01	0.779	0.782	3.525E-47	284	0.895	0.898	Q6IN01.pdb.gz	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
3	AFDB:Q5U2R5	0.466	0.421	1.192E-28	317	0.414	0.372	Q5U2R5.pdb.gz	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
4	AFDB:Q9UQK1	0.468	0.422	3.892E-28	317	0.393	0.353	Q9UQK1.pdb.gz	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
5	AFDB:T1SFR8	0.455	0.455	1.555E-23	285	0.333	0.333	T1SFR8.pdb.gz	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
6	AFDB:F1QYL9	0.434	0.486	4.613E-21	253	0.312	0.352	F1QYL9.pdb.gz
7	AFDB:Q8SXW5	0.447	0.337	4.728E-18	384	0.281	0.208	Q8SXW5.pdb.gz	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
8	AFDB:O95685	0.410	0.391	6.630E-18	299	0.284	0.271	O95685.pdb.gz	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
9	AFDB:D3ZZ26	0.419	0.428	1.379E-17	279	0.260	0.265	D3ZZ26.pdb.gz	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
10	AFDB:Q9VVY3	0.410	0.179	1.315E-16	681	0.277	0.116	Q9VVY3.pdb.gz	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
11	PDB:1j0hA	0.211	0.107	2.298E-4	588	0.028	0.014	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
12	PDB:7vt9A	0.244	0.121	4.038E-4	604	0.032	0.015	7vt9A.pdb.gz
13	PDB:1ea9C	0.233	0.118	5.992E-4	583	0.046	0.022	1ea9C.pdb.gz
14	PDB:1xl6A	0.148	0.147	2.903E-3	291	0.053	0.052	1xl6A.pdb.gz
15	PDB:1yycA	0.237	0.352	6.041E-3	174	0.049	0.080	1yycA.pdb.gz
16	PDB:1jk9B	0.241	0.272	9.482E-3	243	0.056	0.066	1jk9B.pdb.gz	Heterodimeric structure of superoxide dismutase in complex with its metallochaperone.
17	PDB:2ag2A	0.208	0.315	1.003E-2	164	0.046	0.079	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
18	PDB:5j6hA	0.215	0.221	1.257E-2	275	0.032	0.033	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
19	PDB:4edqA	0.189	0.120	1.330E-2	483	0.032	0.019	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
20	PDB:6fgbA	0.179	0.191	1.488E-2	265	0.039	0.042	6fgbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IN01	0.0	538	284	0.895	0.898	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
2	Q86XI6	0.0	596	285	1.000	1.000	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
3	Q8C767	0.0	536	284	0.895	0.898	PPR3B_MOUSE Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
4	Q5U2R5	5.28e-74	231	317	0.456	0.410	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
5	Q9UQK1	4.18e-73	228	317	0.432	0.388	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
6	Q7TMB3	1.02e-68	217	317	0.428	0.385	PPR3C_MOUSE Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
7	T1SFR8	1.03e-45	157	285	0.295	0.295	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
8	Q6NX94	6.90e-45	154	253	0.302	0.340	Q6NX94_DANRE Protein phosphatase 1 regulatory subunit OS=Danio rerio OX=7955 GN=fj66e08 PE=2 SV=1
9	Q8SWT8	1.88e-35	131	330	0.263	0.227	Q8SWT8_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
10	Q9VUF3	3.52e-35	132	384	0.263	0.195	Q9VUF3_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=4 SV=1
11	Q8SXW5	3.31e-34	129	384	0.260	0.193	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
12	O95685	1.94e-26	107	299	0.249	0.237	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
13	D3ZZ26	1.65e-24	101	279	0.214	0.219	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
14	Q9VVY3	1.35e-21	96.7	681	0.218	0.091	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
15	Q00756	1.29e-17	85.1	1109	0.207	0.053	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
16	P0C7L8	2.34e-17	82.0	279	0.189	0.194	PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
17	Q99MR9	4.83e-17	83.2	1089	0.204	0.053	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
18	Q9CW07	5.14e-17	82.0	347	0.214	0.176	PP13G_MOUSE Protein phosphatase 1 regulatory subunit 3G OS=Mus musculus OX=10090 GN=Ppp1r3g PE=1 SV=2
19	P40036	3.15e-11	65.9	548	0.105	0.055	GIP2_YEAST GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
20	Q6ZSY5	1.02e-09	61.2	799	0.112	0.040	PPR3F_HUMAN Protein phosphatase 1 regulatory subunit 3F OS=Homo sapiens OX=9606 GN=PPP1R3F PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16760 CBM53	5.5e-12	57.5	Starch/carbohydrate-binding module (family 53)
2	PF03370 CBM_21	4.3e-30	115.6	Carbohydrate/starch-binding module (family 21)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308318

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326031	0.981	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
2	9606.ENSP00000341779	0.974	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
3	9606.ENSP00000261195	0.959	Glycogen [starch] synthase, liver
4	9606.ENSP00000378769	0.943	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
5	9606.ENSP00000317904	0.934	Glycogen [starch] synthase, muscle
6	9606.ENSP00000428780	0.909	Claudin-23
7	9606.ENSP00000276282	0.903	Malignant fibrous histiocytoma amplified sequence 1
8	9606.ENSP00000311677	0.881	Nuclear inhibitor of protein phosphatase 1
9	9606.ENSP00000284601	0.860	Protein phosphatase 1 regulatory subunit 3A
10	9606.ENSP00000408288	0.849	Protein phosphatase 1 regulatory subunit 3E
11	9606.ENSP00000360035	0.842	Protein phosphatase 1 regulatory subunit 3D
12	9606.ENSP00000365694	0.839	Serine/threonine-protein phosphatase 1 regulatory subunit 10
13	9606.ENSP00000055335	0.828	Protein phosphatase 1 regulatory subunit 3F
14	9606.ENSP00000238994	0.818	Protein phosphatase 1 regulatory subunit 3C
15	9606.ENSP00000355895	0.811	Lysophospholipase-like protein 1
16	9606.ENSP00000478767	0.724	Neurabin-2
17	9606.ENSP00000216180	0.716	Patatin-like phospholipase domain-containing protein 3
18	9606.ENSP00000313504	0.713	Phosphorylase b kinase regulatory subunit beta
19	9606.ENSP00000455607	0.705	Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
20	9606.ENSP00000252575	0.702	Neurocan core protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0016791	0.999	phosphatase activity
GO:0140096	0.995	catalytic activity, acting on a protein
GO:0004721	0.992	phosphoprotein phosphatase activity
GO:0098772	0.921	molecular function regulator activity
GO:0030234	0.899	enzyme regulator activity
GO:0019208	0.770	phosphatase regulator activity
GO:0019888	0.321	protein phosphatase regulator activity
GO:0019903	0.313	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.951	regulation of cellular metabolic process
GO:0032881	0.936	regulation of polysaccharide metabolic process
GO:0009987	0.926	cellular process
GO:0043467	0.926	regulation of generation of precursor metabolites and energy
GO:0008152	0.917	metabolic process
GO:0044237	0.905	cellular metabolic process
GO:0071704	0.897	organic substance metabolic process
GO:0044238	0.890	primary metabolic process
GO:0010675	0.850	regulation of cellular carbohydrate metabolic process
GO:0070873	0.753	regulation of glycogen metabolic process
GO:0009894	0.727	regulation of catabolic process
GO:0043170	0.642	macromolecule metabolic process
GO:0031329	0.458	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.985	protein-containing complex
GO:1903293	0.971	phosphatase complex
GO:0005829	0.915	cytosol
GO:0008287	0.889	protein serine/threonine phosphatase complex
GO:0000164	0.688	protein phosphatase type 1 complex
GO:0042587	0.614	glycogen granule
GO:0005634	0.607	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.999	Phosphoric monoester hydrolases.

[back to server]