StarFunc result for job id Q86XK3

User Input

>input (245 residues)
MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRF
SFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLK
NLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYR
SKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEE
EFIDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XK3	1.000	1.000	1.301E-37	245	1.000	1.000	Q86XK3.pdb.gz	SFR1_HUMAN Swi5-dependent recombination DNA repair protein 1 homolog OS=Homo sapiens OX=9606 GN=SFR1 PE=1 SV=2
2	AFDB:A0A178U8H4	0.251	0.196	3.010E-2	326	0.139	0.104	A0A178U8H4.pdb.gz	A0A178U8H4_ARATH GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17430 PE=1 SV=1
3	AFDB:Q9P7H6	0.218	0.159	7.220E-2	355	0.180	0.124	Q9P7H6.pdb.gz	YLK3_SCHPO Uncharacterized protein C1782.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1782.03 PE=1 SV=1
4	AFDB:A0A024RAW6	0.267	0.160	9.450E-2	441	0.139	0.077	A0A024RAW6.pdb.gz
5	AFDB:Q86IX4	0.225	0.093	1.237E-1	709	0.167	0.058	Q86IX4.pdb.gz	Q86IX4_DICDI Nuclear pore protein OS=Dictyostelium discoideum OX=44689 GN=nup62 PE=3 SV=1
6	AFDB:B9EK46	0.209	0.061	1.619E-1	1203	0.171	0.035	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
7	AFDB:Q9FF75	0.218	0.134	1.619E-1	471	0.127	0.066	Q9FF75.pdb.gz	SUN1_ARATH SUN domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=SUN1 PE=1 SV=1
8	AFDB:M9ND89	0.200	0.106	1.732E-1	541	0.176	0.079	M9ND89.pdb.gz	M9ND89_DROME Nuclear fallout, isoform J OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
9	AFDB:P0DM65	0.179	0.115	1.732E-1	447	0.106	0.058	P0DM65.pdb.gz	BECN2_MOUSE Beclin-2 OS=Mus musculus OX=10090 GN=Becn2 PE=1 SV=2
10	AFDB:Q94CL9	0.085	0.101	1.732E-1	195	0.118	0.149	Q94CL9.pdb.gz	KRP7_ARATH Cyclin-dependent kinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=KRP7 PE=1 SV=2
11	PDB:2p22C	0.190	0.234	2.782	186	0.094	0.124	2p22C.pdb.gz
12	PDB:7rroD1	0.226	0.145	4.166	425	0.065	0.038	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:6elzJ	0.147	0.220	5.452	145	0.069	0.117	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
14	PDB:7d4iRJ	0.203	0.077	8.733	738	0.094	0.031	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
15	PDB:7rroF0	0.146	0.217	9.991	139	0.073	0.129	7rroF0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XK3	1.75e-179	494	245	1.000	1.000	SFR1_HUMAN Swi5-dependent recombination DNA repair protein 1 homolog OS=Homo sapiens OX=9606 GN=SFR1 PE=1 SV=2
2	Q8BP27	1.90e-72	225	319	0.502	0.386	SFR1_MOUSE Swi5-dependent recombination DNA repair protein 1 homolog OS=Mus musculus OX=10090 GN=Sfr1 PE=1 SV=2
3	W5UJB3	0.79	33.5	773	0.069	0.022	W5UJB3_ICTPU Signal transducer and activator of transcription OS=Ictalurus punctatus OX=7998 GN=STAT6 PE=2 SV=1
4	F1M9D0	4.5	30.8	619	0.102	0.040	F1M9D0_RAT Mitogen activated protein kinase kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map3k2 PE=1 SV=2
5	Q9UT24	4.7	31.2	2176	0.122	0.014	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
6	Q9VT41	5.9	30.8	1001	0.118	0.029	INT7_DROME Integrator complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=defl PE=1 SV=1
7	Q9SCJ9	6.1	30.8	1067	0.098	0.022	UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana OX=3702 GN=UBP26 PE=1 SV=3
8	Q62696	7.4	30.4	911	0.053	0.014	DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlg1 PE=1 SV=1
9	J9VI91	9.3	30.0	950	0.065	0.017	J9VI91_CRYNH Pumilio-family RNA binding protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_02810 PE=4 SV=2
10	B7YZE8	9.5	30.0	1322	0.073	0.014	B7YZE8_DROME I[[h]] channel, isoform G OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
11	Q56JH7	9.7	30.0	1319	0.073	0.014	Q56JH7_DROME Hyperpolarization-activated ion channel variant DMIH-A1B2C2 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09041 Aurora-A_bind	2.9e+02	12.9	Aurora-A binding
2	PF10376 Mei5	1.4e-82	288.1	Double-strand recombination repair protein
3	PF17021 Mei5_like	4.7e+02	12.2	Putative double-strand recombination repair-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358742

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316609	0.999	DNA repair protein SWI5 homolog
2	9606.ENSP00000451974	0.923	DNA repair protein XRCC3
3	9606.ENSP00000352271	0.921	DNA repair protein XRCC2
4	9606.ENSP00000336701	0.918	DNA repair protein RAD51 homolog 3
5	9606.ENSP00000466399	0.914	Uncharacterized protein
6	9606.ENSP00000466834	0.914	annotation not available
7	9606.ENSP00000419471	0.913	DNA repair protein RAD51 homolog 2
8	9606.ENSP00000372088	0.831	DNA repair protein RAD51 homolog 1
9	9606.ENSP00000384115	0.756	Meiosis inhibitor protein 1
10	9606.ENSP00000240488	0.731	Meiotic nuclear division protein 1 homolog
11	9606.ENSP00000216024	0.670	Meiotic recombination protein DMC1/LIM15 homolog
12	9606.ENSP00000390778	0.600	Meiosis-specific with OB domain-containing protein
13	9606.ENSP00000351284	0.538	DNA repair protein RAD52 homolog
14	9606.ENSP00000336606	0.517	DNA repair and recombination protein RAD54B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030374	1.000	nuclear receptor coactivator activity
GO:0003676	0.624	nucleic acid binding
GO:0003677	0.335	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0050896	0.994	response to stimulus
GO:0044238	0.993	primary metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0006259	0.982	DNA metabolic process
GO:0065007	0.976	biological regulation
GO:0051716	0.974	cellular response to stimulus
GO:0006310	0.972	DNA recombination
GO:0050794	0.966	regulation of cellular process
GO:0048522	0.940	positive regulation of cellular process
GO:0019219	0.931	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.927	regulation of macromolecule metabolic process
GO:0000724	0.926	double-strand break repair via homologous recombination
GO:0051173	0.690	positive regulation of nitrogen compound metabolic process
GO:0010604	0.682	positive regulation of macromolecule metabolic process
GO:0045935	0.478	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.475	regulation of DNA-templated transcription
GO:0071840	0.443	cellular component organization or biogenesis
GO:0045893	0.433	positive regulation of DNA-templated transcription
GO:0016043	0.428	cellular component organization
GO:0070887	0.426	cellular response to chemical stimulus
GO:0010033	0.397	response to organic substance
GO:0071495	0.354	cellular response to endogenous stimulus
GO:0009725	0.350	response to hormone
GO:0071310	0.338	cellular response to organic substance
GO:0032870	0.302	cellular response to hormone stimulus
GO:0043627	0.300	response to estrogen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.999	chromatin
GO:0140513	0.999	nuclear protein-containing complex
GO:0000228	0.999	nuclear chromosome
GO:0005654	0.964	nucleoplasm
GO:0032798	0.747	Swi5-Sfr1 complex
GO:0005737	0.433	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]