StarFunc result for job id Q86XL3

User Input

>input (938 residues)
MLWPRLAAAEWAALAWELLGASVLLIAVRWLVRRLGPRPGGLGRSGTPVPPPSAAAAPAS
GEMTMDALLARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLSSF
YHHEAGVTALSQDPQRILKPAEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTCSVPP
SDTDTYRAGATASKEPPLYYGVCPVYEDVPARNERIYVYENKKEALQAVKMIKGSRFKAF
STREDAEKFARGICDYFPSPSKTSLPLSPVKTAPLFSNDRLKDGLCLSESETVNKERANS
YKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAK
ENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFAC
KFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELKERIREYLKGHYYVPL
LRAEETSSPVIGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWK
TPPREKAGFLHHVKKSDPERGFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLE
EYLTQQEIGKKAQQETGEREASCRDKATTSGSNSISVRAFLDEDDMSLEEIKNRQNAARN
NSPPTVGAFGHTRCSAFPLEQEADLIEAAEPGGPHSSRNGLCHPLNHSRTLAGKRPKAPR
GEEAHLPPVSDLTVEFDKLNLQNIGRSVSKTPDESTKTKDQILTSRINAVERDLLEPSPA
DQLGNGHRRTESEMSARIAKMSLSPSSPRHEDQLEVTREPARRLFLFGEEPSKLDQDVLA
ALECADVDPHQFPAVHRWKSAVLCYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRN
SVAGSNPAKPGLGSPGRYSPVHGSQLRRMARLAELAAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XL3	1.000	1.000	0.000	938	1.000	1.000	Q86XL3.pdb.gz	ANKL2_HUMAN Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4
2	AFDB:A0A140LI88	0.117	0.061	3.643E-5	1857	0.135	0.068	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
3	PDB:8cs9A	0.100	0.115	5.194E-4	796	0.033	0.039	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	AFDB:A1DRY3	0.055	0.063	7.669E-4	782	0.109	0.130	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
5	AFDB:Q9Y283	0.097	0.087	1.122E-3	1065	0.095	0.084	Q9Y283.pdb.gz	INVS_HUMAN Inversin OS=Homo sapiens OX=9606 GN=INVS PE=1 SV=2
6	PDB:4bszB	0.117	0.618	1.283E-3	150	0.028	0.173	4bszB.pdb.gz
7	PDB:3ehqA	0.109	0.512	3.171E-3	182	0.029	0.148	3ehqA.pdb.gz
8	AFDB:Q8WZ74	0.068	0.045	3.199E-3	1663	0.144	0.081	Q8WZ74.pdb.gz	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
9	AFDB:O89019	0.097	0.087	6.534E-3	1062	0.107	0.094	O89019.pdb.gz	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
10	PDB:6mwqA	0.105	0.178	7.471E-3	493	0.036	0.069	6mwqA.pdb.gz
11	PDB:1wg0A	0.070	0.228	1.147E-2	243	0.031	0.119	1wg0A.pdb.gz
12	PDB:2dvwA	0.101	0.302	1.600E-2	229	0.042	0.170	2dvwA.pdb.gz
13	PDB:1bd8A	0.103	0.407	1.846E-2	156	0.030	0.179	1bd8A.pdb.gz
14	AFDB:Q9BZL4	0.119	0.142	2.253E-2	782	0.106	0.127	Q9BZL4.pdb.gz	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
15	PDB:6v9hC	0.069	0.152	2.456E-2	270	0.030	0.104	6v9hC.pdb.gz
16	PDB:5vkqA	0.093	0.062	2.576E-2	1499	0.035	0.022	5vkqA.pdb.gz
17	PDB:6v9xA	0.101	0.152	2.576E-2	571	0.054	0.089	6v9xA.pdb.gz
18	AFDB:F1QWN1	0.123	0.109	2.726E-2	1063	0.071	0.063	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
19	AFDB:M0QX15	0.100	0.155	3.144E-2	589	0.090	0.143	M0QX15.pdb.gz	M0QX15_HUMAN Ankyrin repeat and LEM domain containing 1 OS=Homo sapiens OX=9606 GN=ANKLE1 PE=1 SV=4
20	AFDB:F1M5H6	0.126	0.106	7.769E-2	1128	0.061	0.051	F1M5H6.pdb.gz	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XL3	0.0	1934	938	1.000	1.000	ANKL2_HUMAN Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4
2	H2KZB2	3.98e-48	183	603	0.146	0.227	ANKL2_CAEEL Ankyrin repeat and LEM domain-containing protein 2 homolog OS=Caenorhabditis elegans OX=6239 GN=lem-4 PE=1 SV=1
3	Q8MQX9	7.30e-40	162	1174	0.100	0.080	ANKL2_DROME Ankyrin repeat and LEM domain-containing protein 2 homolog OS=Drosophila melanogaster OX=7227 GN=Ankle2 PE=1 SV=1
4	Q12955	0.037	40.4	4377	0.021	0.005	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
5	O70511	0.042	40.4	2622	0.021	0.008	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
6	O88521	0.055	40.0	1762	0.021	0.011	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
7	Q5RGX2	0.087	38.9	369	0.019	0.049	Q5RGX2_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
8	Q70X92	0.089	38.5	293	0.021	0.068	Q70X92_DANRE Ankyrin repeat and SOCS box containing protein a OS=Danio rerio OX=7955 GN=asb-a PE=2 SV=1
9	Q94B55	0.094	38.9	456	0.031	0.064	XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana OX=3702 GN=XBAT31 PE=2 SV=1
10	Q0KIE7	0.11	38.9	1549	0.037	0.023	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
11	Q24241	0.11	38.9	1549	0.037	0.023	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
12	Q5RGX5	0.11	38.5	515	0.019	0.035	Q5RGX5_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
13	Q7ZTV0	0.11	38.9	657	0.019	0.027	Q7ZTV0_DANRE Thymopoietin OS=Danio rerio OX=7955 GN=tmpo PE=1 SV=1
14	Q5RGX4	0.12	38.5	685	0.019	0.026	Q5RGX4_DANRE Thymopoietin a OS=Danio rerio OX=7955 GN=LAP2 PE=1 SV=1
15	G5E8K5	0.18	38.1	1961	0.019	0.009	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
16	Q9W0T5	0.21	38.1	956	0.031	0.030	PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster OX=7227 GN=pyx PE=2 SV=2
17	Q9ERC1	0.22	38.1	1912	0.029	0.014	MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus OX=10116 GN=Myo16 PE=1 SV=1
18	Q20684	0.30	37.4	1245	0.015	0.011	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
19	Q8BIZ1	0.35	37.4	1259	0.055	0.041	ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus OX=10090 GN=Anks1b PE=1 SV=3
20	M9PFV2	0.43	37.0	635	0.031	0.046	M9PFV2_DROME Myosin phosphatase targeting subunit 75D, isoform B OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	58	15.5	Ankyrin repeat
2	PF12796 Ank_2	0.41	22.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	41	16.1	Ankyrin repeat
4	PF13637 Ank_4	76	15.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.9e-05	34.5	Ankyrin repeats (many copies)
6	PF01693 Cauli_VI	0.11	24.0	Caulimovirus viroplasmin
7	PF03020 LEM	0.0003	31.6	LEM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310275	0.971	Barrier-to-autointegration factor
2	9606.ENSP00000216639	0.961	Serine/threonine-protein kinase VRK1
3	9606.ENSP00000377036	0.918	Serine/threonine-protein phosphatase 2A activator
4	9606.ENSP00000249396	0.908	NAD-dependent protein deacetylase sirtuin-2
5	9606.ENSP00000418447	0.901	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
6	9606.ENSP00000293760	0.884	LEM domain-containing protein 2
7	9606.ENSP00000308369	0.877	Inner nuclear membrane protein Man1
8	9606.ENSP00000324804	0.875	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
9	9606.ENSP00000358857	0.849	Emerin
10	9606.ENSP00000266732	0.809	Lamina-associated polypeptide 2, isoform alpha
11	9606.ENSP00000325074	0.787	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
12	9606.ENSP00000408002	0.765	Serine/threonine-protein kinase VRK2
13	9606.ENSP00000261366	0.752	Lamin-B1
14	9606.ENSP00000221138	0.750	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
15	9606.ENSP00000357283	0.738	Prelamin-A/C
16	9606.ENSP00000377971	0.669	Ankyrin repeat and LEM domain-containing protein 1
17	9606.ENSP00000317473	0.642	Geranylgeranyl transferase type-2 subunit beta
18	9606.ENSP00000383599	0.638	WD repeat-containing protein 47
19	9606.ENSP00000325326	0.636	Zinc finger protein 335
20	9606.ENSP00000416658	0.630	Nucleoside diphosphate kinase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019888	1.000	protein phosphatase regulator activity
GO:0051721	1.000	protein phosphatase 2A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.988	regulation of biological process
GO:0006998	0.986	nuclear envelope organization
GO:0022607	0.985	cellular component assembly
GO:0050794	0.978	regulation of cellular process
GO:0022402	0.971	cell cycle process
GO:0071763	0.966	nuclear membrane organization
GO:0000278	0.960	mitotic cell cycle
GO:0048522	0.958	positive regulation of cellular process
GO:0019220	0.957	regulation of phosphate metabolic process
GO:1903047	0.949	mitotic cell cycle process
GO:0044091	0.941	membrane biogenesis
GO:0009893	0.940	positive regulation of metabolic process
GO:0060255	0.931	regulation of macromolecule metabolic process
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0071709	0.922	membrane assembly
GO:0048285	0.901	organelle fission
GO:0080090	0.891	regulation of primary metabolic process
GO:0031325	0.882	positive regulation of cellular metabolic process
GO:0051246	0.859	regulation of protein metabolic process
GO:0045937	0.849	positive regulation of phosphate metabolic process
GO:0035303	0.831	regulation of dephosphorylation
GO:0035306	0.805	positive regulation of dephosphorylation
GO:0032502	0.772	developmental process
GO:0048523	0.753	negative regulation of cellular process
GO:0031399	0.628	regulation of protein modification process
GO:0048856	0.619	anatomical structure development
GO:0010604	0.560	positive regulation of macromolecule metabolic process
GO:0032501	0.556	multicellular organismal process
GO:0000280	0.522	nuclear division
GO:0007275	0.515	multicellular organism development
GO:0051173	0.515	positive regulation of nitrogen compound metabolic process
GO:0051247	0.508	positive regulation of protein metabolic process
GO:0065009	0.494	regulation of molecular function
GO:0031468	0.454	nuclear membrane reassembly
GO:0009892	0.452	negative regulation of metabolic process
GO:0140014	0.452	mitotic nuclear division
GO:0031401	0.436	positive regulation of protein modification process
GO:0048731	0.433	system development
GO:0050790	0.418	regulation of catalytic activity
GO:0007399	0.416	nervous system development
GO:0007417	0.389	central nervous system development
GO:0035304	0.388	regulation of protein dephosphorylation
GO:0035307	0.383	positive regulation of protein dephosphorylation
GO:0060548	0.352	negative regulation of cell death
GO:0031324	0.350	negative regulation of cellular metabolic process
GO:0043066	0.341	negative regulation of apoptotic process
GO:0008152	0.323	metabolic process
GO:0042325	0.302	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.995	endoplasmic reticulum membrane
GO:0005634	0.968	nucleus
GO:0005829	0.869	cytosol
GO:0043232	0.420	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]