StarFunc result for job id Q86XP0

User Input

>input (818 residues)
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5iz5A	0.921	0.995	0.000	757	0.923	0.997	5iz5A.pdb.gz
2	PDB:5iz5B	0.851	0.931	0.000	746	0.910	0.997	5iz5B.pdb.gz
3	AFDB:Q50L43	0.965	0.957	0.000	825	0.703	0.697	Q50L43.pdb.gz	PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus OX=10090 GN=Pla2g4d PE=1 SV=3
4	AFDB:Q86XP0	1.000	1.000	0.000	818	1.000	1.000	Q86XP0.pdb.gz	PA24D_HUMAN Cytosolic phospholipase A2 delta OS=Homo sapiens OX=9606 GN=PLA2G4D PE=1 SV=2
5	PDB:5ixcA	0.773	0.917	6.922E-99	684	0.826	0.988	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
6	PDB:5izrC	0.757	0.932	7.224E-94	659	0.789	0.979	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
7	AFDB:P0C869	0.878	0.918	2.600E-86	781	0.488	0.511	P0C869.pdb.gz	PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens OX=9606 GN=PLA2G4B PE=1 SV=2
8	AFDB:P0C871	0.873	0.912	8.028E-86	782	0.471	0.492	P0C871.pdb.gz	PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus OX=10090 GN=Pla2g4b PE=1 SV=1
9	AFDB:Q3MJ16	0.871	0.823	3.600E-82	868	0.458	0.432	Q3MJ16.pdb.gz	PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens OX=9606 GN=PLA2G4E PE=1 SV=4
10	AFDB:Q50L42	0.867	0.812	4.542E-79	875	0.429	0.401	Q50L42.pdb.gz	PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus OX=10090 GN=Pla2g4e PE=1 SV=1
11	AFDB:Q68DD2	0.820	0.791	3.256E-74	849	0.410	0.395	Q68DD2.pdb.gz	PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens OX=9606 GN=PLA2G4F PE=1 SV=3
12	AFDB:Q50L41	0.822	0.788	5.453E-73	855	0.400	0.382	Q50L41.pdb.gz	PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus OX=10090 GN=Pla2g4f PE=1 SV=3
13	AFDB:P50393	0.572	0.620	1.031E-47	752	0.249	0.271	P50393.pdb.gz	PA24A_RAT Cytosolic phospholipase A2 OS=Rattus norvegicus OX=10116 GN=Pla2g4a PE=1 SV=1
14	AFDB:A0A0R4ICC9	0.580	0.654	1.244E-47	720	0.254	0.289	A0A0R4ICC9.pdb.gz
15	PDB:1cjyA	0.549	0.703	1.056E-42	633	0.246	0.318	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
16	PDB:6kxkD	0.126	0.177	5.832E-7	553	0.046	0.069	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
17	PDB:4rj9A	0.109	0.495	1.126E-6	161	0.049	0.248	4rj9A.pdb.gz
18	PDB:5a52A	0.110	0.523	1.639E-6	154	0.032	0.169	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:5a50A	0.127	0.562	2.173E-6	165	0.038	0.188	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:3nsjA	0.126	0.192	3.314E-5	530	0.023	0.036	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C869	0.0	750	781	0.493	0.516	PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens OX=9606 GN=PLA2G4B PE=1 SV=2
2	P0C871	0.0	744	782	0.471	0.492	PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus OX=10090 GN=Pla2g4b PE=1 SV=1
3	Q3MJ16	0.0	672	868	0.460	0.433	PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens OX=9606 GN=PLA2G4E PE=1 SV=4
4	Q50L41	0.0	593	855	0.411	0.393	PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus OX=10090 GN=Pla2g4f PE=1 SV=3
5	Q50L42	0.0	650	875	0.427	0.399	PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus OX=10090 GN=Pla2g4e PE=1 SV=1
6	Q50L43	0.0	1170	825	0.709	0.703	PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus OX=10090 GN=Pla2g4d PE=1 SV=3
7	Q68DD2	0.0	588	849	0.423	0.408	PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens OX=9606 GN=PLA2G4F PE=1 SV=3
8	Q86XP0	0.0	1686	818	1.000	1.000	PA24D_HUMAN Cytosolic phospholipase A2 delta OS=Homo sapiens OX=9606 GN=PLA2G4D PE=1 SV=2
9	P47712	1.02e-76	266	749	0.229	0.250	PA24A_HUMAN Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2
10	P47713	9.24e-76	263	748	0.224	0.245	PA24A_MOUSE Cytosolic phospholipase A2 OS=Mus musculus OX=10090 GN=Pla2g4a PE=1 SV=1
11	P50392	1.23e-75	263	741	0.230	0.254	PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio OX=7955 GN=pla2g4a PE=2 SV=1
12	P50393	1.29e-75	263	752	0.222	0.242	PA24A_RAT Cytosolic phospholipase A2 OS=Rattus norvegicus OX=10116 GN=Pla2g4a PE=1 SV=1
13	Q9UP65	8.74e-47	177	541	0.177	0.268	PA24C_HUMAN Cytosolic phospholipase A2 gamma OS=Homo sapiens OX=9606 GN=PLA2G4C PE=1 SV=2
14	Q64GA5	9.97e-28	121	597	0.094	0.129	PA24C_MOUSE Cytosolic phospholipase A2 gamma OS=Mus musculus OX=10090 GN=Pla2g4c PE=1 SV=1
15	P0CU02	5.97e-10	65.1	673	0.084	0.103	PLB4_SCHPO Putative lysophospholipase SPAC977.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC977.09c PE=2 SV=1
16	P0CU03	5.97e-10	65.1	673	0.084	0.103	PLB7_SCHPO Putative lysophospholipase SPBC1348.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1348.10c PE=3 SV=1
17	Q8L706	1.74e-09	63.5	560	0.035	0.052	SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana OX=3702 GN=SYT5 PE=2 SV=1
18	Q9M2D4	2.63e-09	63.5	972	0.040	0.034	MCTP8_ARATH Multiple C2 domain and transmembrane region protein 8 OS=Arabidopsis thaliana OX=3702 GN=MCTP8 PE=2 SV=1
19	O13857	3.81e-09	62.8	662	0.079	0.098	PLB2_SCHPO Putative lysophospholipase SPAC1A6.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1A6.03c PE=3 SV=4
20	Q9SKA3	1.23e-08	61.2	1029	0.040	0.032	MCTP6_ARATH Multiple C2 domain and transmembrane region protein 6 OS=Arabidopsis thaliana OX=3702 GN=MCTP6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.8e-14	65.2	C2 domain
2	PF18695 cPLA2_C2	1.8e-26	103.7	Cytosolic phospholipases A2 C2-domain
3	PF01735 PLA2_B	1.7e-22	91.1	Lysophospholipase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290472

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364249	0.908	Calcium-dependent phospholipase A2
2	9606.ENSP00000360141	0.874	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
3	9606.ENSP00000286548	0.834	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000363400	0.796	Platelet-activating factor acetylhydrolase 2, cytoplasmic
5	9606.ENSP00000219345	0.793	Group XV phospholipase A2
6	9606.ENSP00000407509	0.767	Neuropathy target esterase
7	9606.ENSP00000274793	0.764	Platelet-activating factor acetylhydrolase
8	9606.ENSP00000384610	0.762	Patatin-like phospholipase domain-containing protein 7
9	9606.ENSP00000320337	0.758	HRAS-like suppressor 3
10	9606.ENSP00000330442	0.758	Phospholipase B1, membrane-associated
11	9606.ENSP00000435289	0.745	Platelet-activating factor acetylhydrolase IB subunit beta
12	9606.ENSP00000441980	0.719	Choline/ethanolaminephosphotransferase 1
13	9606.ENSP00000229266	0.718	Cholinephosphotransferase 1
14	9606.ENSP00000263088	0.708	Phospholipase D2
15	9606.ENSP00000315167	0.708	Arachidonate 12-lipoxygenase, 12R-type
16	9606.ENSP00000327608	0.707	ADAMTS-like protein 5
17	9606.ENSP00000354612	0.699	Prostaglandin G/H synthase 1
18	9606.ENSP00000380378	0.693	Platelet-activating factor acetylhydrolase IB subunit alpha
19	9606.ENSP00000356438	0.688	Prostaglandin G/H synthase 2
20	9606.ENSP00000369530	0.687	Arachidonate 15-lipoxygenase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047498	0.998	calcium-dependent phospholipase A2 activity
GO:0008970	0.995	phospholipase A1 activity
GO:0005488	0.900	binding
GO:0005515	0.456	protein binding
GO:0004622	0.378	lysophospholipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0006629	0.995	lipid metabolic process
GO:0006644	0.994	phospholipid metabolic process
GO:0006650	0.946	glycerophospholipid metabolic process
GO:0016042	0.895	lipid catabolic process
GO:0044242	0.825	cellular lipid catabolic process
GO:0046503	0.785	glycerolipid catabolic process
GO:0009395	0.783	phospholipid catabolic process
GO:0046471	0.759	phosphatidylglycerol metabolic process
GO:0046475	0.727	glycerophospholipid catabolic process
GO:0046488	0.594	phosphatidylinositol metabolic process
GO:0006807	0.416	nitrogen compound metabolic process
GO:0065007	0.392	biological regulation
GO:1901564	0.365	organonitrogen compound metabolic process
GO:0050789	0.337	regulation of biological process
GO:0050794	0.331	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.994	cytosol
GO:0043226	0.889	organelle
GO:0043229	0.832	intracellular organelle
GO:0043227	0.761	membrane-bounded organelle
GO:0043231	0.699	intracellular membrane-bounded organelle
GO:0016020	0.685	membrane
GO:0012505	0.399	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15801	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	1.000	phospholipase A2.
RHEA:18689	0.995	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.32	0.995	phospholipase A1.
RHEA:15177	0.378	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.378	lysophospholipase.

[back to server]