StarFunc result for job id Q86XP1

User Input

>input (1220 residues)
MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLG
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
TDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
VKRILQGIKELGRSTPQSEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PUQ8	0.663	0.663	0.000	1220	0.648	0.648	E9PUQ8.pdb.gz	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
2	AFDB:Q86XP1	1.000	1.000	0.000	1220	1.000	1.000	Q86XP1.pdb.gz	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
3	AFDB:Q5KSL6	0.489	0.470	4.748E-90	1271	0.365	0.350	Q5KSL6.pdb.gz	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
4	AFDB:Q01583	0.364	0.367	5.972E-47	1211	0.194	0.196	Q01583.pdb.gz	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
5	AFDB:Q9Y6T7	0.365	0.547	6.533E-40	804	0.178	0.270	Q9Y6T7.pdb.gz	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
6	AFDB:Q9FFN7	0.341	0.569	5.248E-32	712	0.150	0.257	Q9FFN7.pdb.gz	DGK2_ARATH Diacylglycerol kinase 2 OS=Arabidopsis thaliana OX=3702 GN=DGK2 PE=1 SV=1
7	AFDB:D3YWQ0	0.356	0.404	2.836E-31	1071	0.170	0.193	D3YWQ0.pdb.gz	DGKI_MOUSE Diacylglycerol kinase iota OS=Mus musculus OX=10090 GN=Dgki PE=1 SV=1
8	PDB:3ljuX	0.076	0.237	4.489E-6	373	0.022	0.072	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	PDB:6bbpA	0.073	0.168	1.186E-5	520	0.020	0.048	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
10	PDB:6u3eA	0.075	0.223	1.696E-5	397	0.022	0.068	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
11	AFDB:Q9HAU0	0.079	0.086	5.538E-5	1116	0.088	0.096	Q9HAU0.pdb.gz	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
12	PDB:4l02A	0.108	0.332	5.787E-5	360	0.018	0.061	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
13	PDB:6hhgA	0.072	0.219	9.649E-5	386	0.018	0.057	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
14	PDB:2bonA	0.099	0.362	2.549E-4	287	0.020	0.084	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
15	PDB:2bonB	0.090	0.362	3.292E-4	265	0.016	0.072	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
16	AFDB:O14340	0.072	0.067	7.138E-4	1310	0.070	0.065	O14340.pdb.gz	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
17	PDB:1u0tB	0.076	0.285	9.632E-4	276	0.018	0.080	1u0tB.pdb.gz
18	PDB:5ejgC	0.076	0.353	1.067E-3	218	0.012	0.069	5ejgC.pdb.gz
19	PDB:7rx9A	0.072	0.197	1.182E-3	432	0.015	0.042	7rx9A.pdb.gz
20	AFDB:Q9NR80	0.053	0.084	2.198E-3	690	0.060	0.106	Q9NR80.pdb.gz	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YXJ0	0.0	2288	1211	0.913	0.920	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2
2	E9PUQ8	0.0	1531	1220	0.645	0.645	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
3	Q16760	0.0	1518	1214	0.641	0.644	DGKD_HUMAN Diacylglycerol kinase delta OS=Homo sapiens OX=9606 GN=DGKD PE=1 SV=4
4	Q64398	0.0	2127	1154	0.859	0.908	DGKH_MESAU Diacylglycerol kinase eta OS=Mesocricetus auratus OX=10036 GN=DGKH PE=1 SV=1
5	Q86XP1	0.0	2535	1220	1.000	1.000	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
6	Q5KSL6	2.62e-144	471	1271	0.192	0.184	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
7	Q01583	1.75e-60	229	1211	0.098	0.099	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
8	Q91WG7	1.79e-58	219	788	0.098	0.152	DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus OX=10090 GN=Dgkg PE=1 SV=1
9	P49619	1.01e-56	214	791	0.104	0.161	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
10	Q6NS52	1.44e-56	213	802	0.099	0.151	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
11	Q9Y6T7	7.80e-56	211	804	0.099	0.150	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
12	P49620	3.16e-55	209	788	0.096	0.148	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
13	P49621	5.35e-55	208	801	0.100	0.152	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
14	P23743	8.40e-54	204	735	0.100	0.166	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
15	P20192	9.17e-54	204	734	0.100	0.166	DGKA_PIG Diacylglycerol kinase alpha OS=Sus scrofa OX=9823 GN=DGKA PE=1 SV=1
16	Q03603	3.41e-53	203	795	0.099	0.152	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
17	P51556	1.77e-52	199	727	0.098	0.164	DGKA_RAT Diacylglycerol kinase alpha OS=Rattus norvegicus OX=10116 GN=Dgka PE=1 SV=1
18	O88673	1.78e-51	197	730	0.098	0.164	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
19	Q9R1C6	4.71e-49	186	564	0.111	0.241	DGKE_MOUSE Diacylglycerol kinase epsilon OS=Mus musculus OX=10090 GN=Dgke PE=1 SV=1
20	I3L112	1.14e-48	182	456	0.111	0.298	I3L112_HUMAN Diacylglycerol kinase (Fragment) OS=Homo sapiens OX=9606 GN=DGKE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	2.2e-13	61.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	4.7	18.9	C1 domain
3	PF00609 DAGK_acc	5.9e-47	171.5	Diacylglycerol kinase accessory domain
4	PF00781 DAGK_cat	1.1e-24	97.8	Diacylglycerol kinase catalytic domain
5	PF00169 PH	7.8e-12	57.0	PH domain
6	PF15413 PH_11	27	16.7	Pleckstrin homology domain
7	PF15409 PH_8	0.23	23.1	Pleckstrin homology domain
8	PF00536 SAM_1	1.6e-11	55.8	SAM domain (Sterile alpha motif)
9	PF07647 SAM_2	8.9e-14	62.7	SAM domain (Sterile alpha motif)
10	PF02198 SAM_PNT	4.4e+02	12.3	Sterile alpha motif (SAM)/Pointed domain
11	PF19279 YegS_C	5.5e+02	11.8	YegS C-terminal NAD kinase beta sandwich-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419879	0.761	Phosphatidate cytidylyltransferase 2
2	9606.ENSP00000295887	0.749	Phosphatidate cytidylyltransferase 1
3	9606.ENSP00000314036	0.749	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
4	9606.ENSP00000388631	0.747	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
5	9606.ENSP00000285518	0.746	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
6	9606.ENSP00000479636	0.744	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
7	9606.ENSP00000406674	0.741	2-acylglycerol O-acyltransferase 1
8	9606.ENSP00000302177	0.731	Lysophospholipid acyltransferase 2
9	9606.ENSP00000482457	0.731	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
10	9606.ENSP00000260402	0.729	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
11	9606.ENSP00000266505	0.727	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
12	9606.ENSP00000367762	0.725	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
13	9606.ENSP00000360431	0.722	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
14	9606.ENSP00000198801	0.721	2-acylglycerol O-acyltransferase 2
15	9606.ENSP00000324944	0.716	Lysophospholipid acyltransferase 1
16	9606.ENSP00000263088	0.715	Phospholipase D2
17	9606.ENSP00000228027	0.713	Diacylglycerol O-acyltransferase 2
18	9606.ENSP00000229266	0.712	Cholinephosphotransferase 1
19	9606.ENSP00000482264	0.708	Diacylglycerol O-acyltransferase 1
20	9606.ENSP00000355607	0.706	Glyceronephosphate O-acyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004143	1.000	diacylglycerol kinase activity
GO:0005515	0.999	protein binding
GO:0042802	0.936	identical protein binding
GO:0019900	0.921	kinase binding
GO:0019904	0.803	protein domain specific binding
GO:0032093	0.611	SAM domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006654	0.989	phosphatidic acid biosynthetic process
GO:0006639	0.987	acylglycerol metabolic process
GO:0030258	0.984	lipid modification
GO:0016310	0.918	phosphorylation
GO:0065007	0.900	biological regulation
GO:0050794	0.773	regulation of cellular process
GO:0050896	0.684	response to stimulus
GO:0007154	0.575	cell communication
GO:0023052	0.572	signaling
GO:0051716	0.568	cellular response to stimulus
GO:0007165	0.546	signal transduction
GO:0032501	0.399	multicellular organismal process
GO:0046339	0.359	diacylglycerol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005829	0.967	cytosol
GO:0031982	0.895	vesicle
GO:0031410	0.753	cytoplasmic vesicle
GO:0043232	0.620	intracellular non-membrane-bounded organelle
GO:0032991	0.594	protein-containing complex
GO:0005634	0.317	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	1.000	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	1.000	diacylglycerol kinase (ATP).

[back to server]