StarFunc result for job id Q86XQ3

User Input

>input (398 residues)
MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTV
TSNAFFMALWTSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVI
IIIVMFLPYALRQLMGKQFTYLYIADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASV
LLLLFLLMYIFAILGFCLFGSPDNGDHDNWGNLAAAFFTLFSLATVDGWTDLQKQLDNRE
FALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQR
QQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQD
TTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XQ3	1.000	1.000	5.888E-52	398	1.000	1.000	Q86XQ3.pdb.gz	CTSR3_HUMAN Cation channel sperm-associated protein 3 OS=Homo sapiens OX=9606 GN=CATSPER3 PE=2 SV=1
2	AFDB:Q80W99	0.747	0.752	1.581E-34	395	0.626	0.630	Q80W99.pdb.gz	CTSR3_MOUSE Cation channel sperm-associated protein 3 OS=Mus musculus OX=10090 GN=Catsper3 PE=1 SV=2
3	PDB:7eebC	0.625	0.872	4.374E-22	278	0.475	0.680	7eebC.pdb.gz	Structure of a mammalian sperm cation channel complex.
4	AFDB:Q7RTX7	0.549	0.467	1.356E-12	472	0.191	0.161	Q7RTX7.pdb.gz	CTSR4_HUMAN Cation channel sperm-associated protein 4 OS=Homo sapiens OX=9606 GN=CATSPER4 PE=1 SV=1
5	AFDB:Q8BVN3	0.543	0.492	1.999E-12	442	0.206	0.186	Q8BVN3.pdb.gz	CTSR4_MOUSE Cation channel sperm-associated protein 4 OS=Mus musculus OX=10090 GN=Catsper4 PE=1 SV=1
6	AFDB:Q0ABW0	0.591	0.794	3.245E-12	288	0.153	0.212	Q0ABW0.pdb.gz	Q0ABW0_ALKEH Ion transport protein OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=Mlg_0322 PE=1 SV=1
7	AFDB:Q0VNY2	0.560	0.766	9.427E-12	283	0.153	0.216	Q0VNY2.pdb.gz	Q0VNY2_ALCBS Ion transport protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=ABO_1668 PE=1 SV=1
8	AFDB:Q8NEC5	0.548	0.292	4.035E-11	780	0.176	0.090	Q8NEC5.pdb.gz	CTSR1_HUMAN Cation channel sperm-associated protein 1 OS=Homo sapiens OX=9606 GN=CATSPER1 PE=1 SV=3
9	AFDB:A8EVM5	0.562	0.816	7.953E-11	267	0.158	0.236	A8EVM5.pdb.gz	A8EVM5_ALIB4 Ion transport protein OS=Aliarcobacter butzleri (strain RM4018) OX=367737 GN=Abu_1752 PE=1 SV=1
10	AFDB:F7IVA8	0.539	0.811	8.348E-11	258	0.141	0.217	F7IVA8.pdb.gz	F7IVA8_RUEPO Voltage-gated sodium channel OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=SPO0030 PE=1 SV=1
11	PDB:5vb2D	0.545	0.791	2.320E-10	268	0.156	0.231	5vb2D.pdb.gz
12	AFDB:Q91ZR5	0.557	0.338	4.779E-10	686	0.168	0.098	Q91ZR5.pdb.gz	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
13	PDB:7eebB	0.584	0.804	4.049E-9	281	0.161	0.228	7eebB.pdb.gz	Structure of a mammalian sperm cation channel complex.
14	PDB:7eebD	0.503	0.791	6.111E-8	242	0.146	0.240	7eebD.pdb.gz	Structure of a mammalian sperm cation channel complex.
15	PDB:7wliA	0.498	0.191	1.393E-7	1135	0.168	0.059	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
16	PDB:7k48A	0.481	0.798	1.775E-7	229	0.128	0.223	7k48A.pdb.gz
17	PDB:7eebA	0.514	0.756	1.956E-7	258	0.128	0.198	7eebA.pdb.gz	Structure of a mammalian sperm cation channel complex.
18	PDB:7vfsA	0.476	0.167	3.175E-7	1266	0.186	0.058	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
19	PDB:7mixA	0.500	0.167	1.067E-6	1326	0.168	0.051	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
20	PDB:7sx3A	0.454	0.146	1.497E-6	1386	0.121	0.035	7sx3A.pdb.gz	Structural architecture of the human NALCN channelosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XQ3	0.0	822	398	1.000	1.000	CTSR3_HUMAN Cation channel sperm-associated protein 3 OS=Homo sapiens OX=9606 GN=CATSPER3 PE=2 SV=1
2	Q80W99	1.70e-176	499	395	0.643	0.648	CTSR3_MOUSE Cation channel sperm-associated protein 3 OS=Mus musculus OX=10090 GN=Catsper3 PE=1 SV=2
3	Q8BVN3	1.90e-19	92.0	442	0.166	0.149	CTSR4_MOUSE Cation channel sperm-associated protein 4 OS=Mus musculus OX=10090 GN=Catsper4 PE=1 SV=1
4	Q0ABW0	8.22e-18	85.1	288	0.148	0.205	Q0ABW0_ALKEH Ion transport protein OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=Mlg_0322 PE=1 SV=1
5	O88457	1.24e-17	87.8	1765	0.186	0.042	SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn11a PE=1 SV=1
6	Q9R053	3.48e-17	86.3	1765	0.168	0.038	SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus OX=10090 GN=Scn11a PE=1 SV=2
7	P35500	3.13e-16	83.2	2131	0.176	0.033	SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster OX=7227 GN=para PE=2 SV=3
8	Q7RTX7	5.39e-16	81.6	472	0.148	0.125	CTSR4_HUMAN Cation channel sperm-associated protein 4 OS=Homo sapiens OX=9606 GN=CATSPER4 PE=1 SV=1
9	O95180	7.31e-16	82.4	2353	0.156	0.026	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
10	Q5SUG2	8.68e-15	79.0	2176	0.181	0.033	Q5SUG2_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
11	Q27YN9	9.05e-15	79.0	2265	0.181	0.032	Q27YN9_MOUSE T-type calcium channel alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
12	Q5SUF9	9.05e-15	79.0	2265	0.181	0.032	Q5SUF9_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
13	Q6PFV8	9.12e-15	79.0	2248	0.181	0.032	Q6PFV8_MOUSE Cacna1g protein OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
14	E9PWL1	9.13e-15	79.0	2272	0.181	0.032	E9PWL1_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
15	O54898	9.29e-15	79.0	2254	0.181	0.032	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
16	Q5SUG1	9.45e-15	79.0	2248	0.181	0.032	Q5SUG1_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q5SUF5	9.62e-15	79.0	2247	0.181	0.032	Q5SUF5_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
18	Q5SUF8	9.80e-15	78.6	2254	0.181	0.032	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
19	Q9WUT2	1.33e-14	78.2	2295	0.171	0.030	Q9WUT2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
20	Q5SUG4	1.37e-14	78.2	2295	0.171	0.030	Q5SUG4_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	7.1e-30	115.6	Ion transport protein
2	PF08016 PKD_channel	0.0017	29.3	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282611

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000421544	0.906	Pterin-4-alpha-carbinolamine dehydratase 2
2	9606.ENSP00000386962	0.896	Cation channel sperm-associated protein subunit gamma
3	9606.ENSP00000256343	0.887	Cation channel sperm-associated protein subunit beta
4	9606.ENSP00000371037	0.879	Cation channel sperm-associated protein subunit delta
5	9606.ENSP00000390423	0.834	Cation channel sperm-associated protein 4
6	9606.ENSP00000309052	0.831	Cation channel sperm-associated protein 1
7	9606.ENSP00000371180	0.826	Cation channel sperm-associated protein 2
8	9606.ENSP00000301050	0.803	Voltage-dependent L-type calcium channel subunit beta-3
9	9606.ENSP00000438949	0.800	Voltage-dependent L-type calcium channel subunit beta-4
10	9606.ENSP00000320025	0.797	Voltage-dependent L-type calcium channel subunit beta-2
11	9606.ENSP00000349320	0.790	Voltage-dependent calcium channel subunit alpha-2/delta-1
12	9606.ENSP00000372169	0.789	Voltage-dependent calcium channel subunit alpha-2/delta-4
13	9606.ENSP00000226021	0.782	Voltage-dependent calcium channel gamma-1 subunit
14	9606.ENSP00000355492	0.779	Cation channel sperm-associated protein subunit epsilon
15	9606.ENSP00000352608	0.772	Ryanodine receptor 1
16	9606.ENSP00000252729	0.749	Voltage-dependent calcium channel gamma-6 subunit
17	9606.ENSP00000334198	0.742	Voltage-dependent T-type calcium channel subunit alpha-1H
18	9606.ENSP00000360423	0.742	Voltage-dependent N-type calcium channel subunit alpha-1B
19	9606.ENSP00000270458	0.740	Voltage-dependent calcium channel gamma-8 subunit
20	9606.ENSP00000005284	0.737	Voltage-dependent calcium channel gamma-3 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0006811	0.971	monoatomic ion transport
GO:0030001	0.958	metal ion transport
GO:0032501	0.943	multicellular organismal process
GO:0007018	0.871	microtubule-based movement
GO:0022414	0.786	reproductive process
GO:0048856	0.695	anatomical structure development
GO:0007286	0.683	spermatid development
GO:0003341	0.678	cilium movement
GO:0048469	0.610	cell maturation
GO:0030317	0.562	flagellated sperm motility
GO:0065007	0.363	biological regulation
GO:0050896	0.362	response to stimulus
GO:0050789	0.348	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.727	intracellular anatomical structure
GO:0032991	0.628	protein-containing complex
GO:0043226	0.526	organelle
GO:0043227	0.457	membrane-bounded organelle
GO:1902495	0.452	transmembrane transporter complex
GO:0034703	0.365	cation channel complex
GO:0098797	0.350	plasma membrane protein complex
GO:0034704	0.343	calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]