StarFunc result for job id Q86XR7

User Input

>input (235 residues)
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XR7	1.000	1.000	4.610E-42	235	1.000	1.000	Q86XR7.pdb.gz	TCAM2_HUMAN TIR domain-containing adapter molecule 2 OS=Homo sapiens OX=9606 GN=TICAM2 PE=1 SV=1
2	AFDB:Q8BJQ4	0.739	0.748	1.128E-34	232	0.740	0.750	Q8BJQ4.pdb.gz	TCAM2_MOUSE TIR domain-containing adapter molecule 2 OS=Mus musculus OX=10090 GN=Ticam2 PE=1 SV=1
3	AFDB:B0L0T7	0.635	0.276	8.385E-14	566	0.264	0.110	B0L0T7.pdb.gz
4	AFDB:Q80UF7	0.598	0.203	1.064E-11	732	0.255	0.082	Q80UF7.pdb.gz	TCAM1_MOUSE TIR domain-containing adapter molecule 1 OS=Mus musculus OX=10090 GN=Ticam1 PE=1 SV=1
5	AFDB:Q8IUC6	0.626	0.217	5.023E-11	712	0.260	0.086	Q8IUC6.pdb.gz	TCAM1_HUMAN TIR domain-containing adapter molecule 1 OS=Homo sapiens OX=9606 GN=TICAM1 PE=1 SV=1
6	AFDB:Q99JY1	0.485	0.474	6.305E-7	241	0.179	0.174	Q99JY1.pdb.gz	TIRAP_MOUSE Toll/interleukin-1 receptor domain-containing adapter protein OS=Mus musculus OX=10090 GN=Tirap PE=1 SV=1
7	AFDB:P58753	0.494	0.523	7.596E-7	221	0.166	0.176	P58753.pdb.gz	TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adapter protein OS=Homo sapiens OX=9606 GN=TIRAP PE=1 SV=2
8	AFDB:I1GTC2	0.417	0.435	8.556E-6	224	0.132	0.138	I1GTC2.pdb.gz	BDTIR_BRADI Probable 2' cyclic ADP-D-ribose synthase BdTIR OS=Brachypodium distachyon OX=15368 GN=BRADI_1g24377v3 PE=1 SV=1
9	AFDB:F1QMN8	0.431	0.119	2.041E-5	989	0.136	0.032	F1QMN8.pdb.gz	F1QMN8_DANRE Toll-like receptor 21 OS=Danio rerio OX=7955 GN=TLR21.1 PE=3 SV=1
10	AFDB:Q9VPH1	0.438	0.133	4.299E-5	900	0.119	0.031	Q9VPH1.pdb.gz	Q9VPH1_DROME Toll-9, isoform A OS=Drosophila melanogaster OX=7227 GN=Toll-9 PE=3 SV=1
11	PDB:7anwA	0.385	0.154	2.065E-3	645	0.111	0.040	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
12	PDB:7jlxA	0.316	0.428	8.093E-3	166	0.068	0.096	7jlxA.pdb.gz
13	PDB:7cm7A	0.381	0.161	1.250E-2	620	0.089	0.034	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
14	PDB:4zhjB	0.227	0.059	5.213E-2	1233	0.047	0.009	4zhjB.pdb.gz
15	PDB:1u0tB	0.268	0.236	7.110E-2	276	0.089	0.076	1u0tB.pdb.gz
16	PDB:2mokA	0.213	0.264	1.805E-1	176	0.051	0.068	2mokA.pdb.gz	NMR study of YqcA from Escherichia coli
17	PDB:3esxB	0.238	0.309	2.313E-1	169	0.060	0.083	3esxB.pdb.gz	Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase
18	PDB:3mcaA	0.188	0.136	2.313E-1	377	0.094	0.058	3mcaA.pdb.gz
19	PDB:5gxuA	0.245	0.123	2.313E-1	552	0.034	0.014	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
20	PDB:6agbJ	0.139	0.118	2.313E-1	293	0.060	0.048	6agbJ.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XR7	8.26e-180	494	235	1.000	1.000	TCAM2_HUMAN TIR domain-containing adapter molecule 2 OS=Homo sapiens OX=9606 GN=TICAM2 PE=1 SV=1
2	Q8BJQ4	3.84e-126	358	232	0.745	0.754	TCAM2_MOUSE TIR domain-containing adapter molecule 2 OS=Mus musculus OX=10090 GN=Ticam2 PE=1 SV=1
3	Q1LUQ2	9.30e-21	92.4	566	0.234	0.097	Q1LUQ2_DANRE TIR domain-containing adapter molecule 1 OS=Danio rerio OX=7955 GN=trif PE=2 SV=1
4	Q8IUC6	9.59e-14	72.0	712	0.238	0.079	TCAM1_HUMAN TIR domain-containing adapter molecule 1 OS=Homo sapiens OX=9606 GN=TICAM1 PE=1 SV=1
5	Q80UF7	5.51e-13	70.1	732	0.221	0.071	TCAM1_MOUSE TIR domain-containing adapter molecule 1 OS=Mus musculus OX=10090 GN=Ticam1 PE=1 SV=1
6	M0RA08	1.45e-11	65.9	734	0.221	0.071	M0RA08_RAT TIR domain-containing adapter molecule 1 OS=Rattus norvegicus OX=10116 GN=Ticam1 PE=4 SV=2
7	F8W3J5	0.13	35.8	881	0.060	0.016	F8W3J5_DANRE Toll-like receptor 5b OS=Danio rerio OX=7955 GN=tlr5 PE=1 SV=1
8	Q9QUN7	0.13	35.8	784	0.089	0.027	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
9	B3DIN1	0.14	35.8	875	0.060	0.016	B3DIN1_DANRE Tlr5b protein OS=Danio rerio OX=7955 GN=tlr5b PE=1 SV=1
10	Q6YGU2	0.15	35.4	784	0.081	0.024	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
11	E9PTD9	0.16	35.4	784	0.081	0.024	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
12	Q99JY1	0.16	35.0	241	0.085	0.083	TIRAP_MOUSE Toll/interleukin-1 receptor domain-containing adapter protein OS=Mus musculus OX=10090 GN=Tirap PE=1 SV=1
13	Q9V477	0.17	35.4	1346	0.055	0.010	TOLL8_DROME Toll-like receptor Tollo OS=Drosophila melanogaster OX=7227 GN=Tollo PE=1 SV=1
14	C0LP03	0.20	35.0	859	0.060	0.016	C0LP03_RAT Toll-like receptor 5 OS=Rattus norvegicus OX=10116 GN=Tlr5 PE=2 SV=1
15	Q9JLF7	0.20	35.0	859	0.060	0.016	TLR5_MOUSE Toll-like receptor 5 OS=Mus musculus OX=10090 GN=Tlr5 PE=1 SV=1
16	G3V6F8	0.21	35.0	871	0.060	0.016	G3V6F8_RAT Toll-like receptor 5 OS=Rattus norvegicus OX=10116 GN=Tlr5 PE=3 SV=1
17	Q5GR02	0.21	35.0	862	0.060	0.016	Q5GR02_CHICK Toll-like receptor 5 OS=Gallus gallus OX=9031 GN=TLR5 PE=3 SV=1
18	P58753	0.27	34.3	221	0.060	0.063	TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adapter protein OS=Homo sapiens OX=9606 GN=TIRAP PE=1 SV=2
19	F8W4F1	0.40	34.3	881	0.055	0.015	F8W4F1_DANRE Toll-like receptor 5 OS=Danio rerio OX=7955 GN=tlr5a PE=3 SV=2
20	Q15399	0.66	33.5	786	0.081	0.024	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01582 TIR	2.6	19.3	TIR domain
2	PF13676 TIR_2	9.5e-05	34.4	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363089	0.999	Toll-like receptor 4
2	9606.ENSP00000433623	0.986	TNF receptor-associated factor 6
3	9606.ENSP00000248244	0.981	TIR domain-containing adapter molecule 1
4	9606.ENSP00000358997	0.964	Interleukin-1 receptor-associated kinase 1
5	9606.ENSP00000390651	0.963	Interleukin-1 receptor-associated kinase 4
6	9606.ENSP00000386380	0.952	Interleukin-1 receptor type 1
7	9606.ENSP00000263341	0.938	Interleukin-1 beta
8	9606.ENSP00000314807	0.929	Interleukin 1 receptor accessory protein
9	9606.ENSP00000468032	0.924	Sterile alpha and TIR motif-containing protein 1
10	9606.ENSP00000340305	0.920	Ubiquitin-conjugating enzyme E2 variant 1
11	9606.ENSP00000260010	0.918	Toll-like receptor 2
12	9606.ENSP00000316176	0.914	Ubiquitin-conjugating enzyme E2 N
13	9606.ENSP00000454207	0.908	TNF receptor-associated factor 3
14	9606.ENSP00000263708	0.907	Tyrosine-protein phosphatase non-receptor type 4
15	9606.ENSP00000263464	0.904	Baculoviral IAP repeat-containing protein 3
16	9606.ENSP00000477613	0.904	Baculoviral IAP repeat-containing protein 2
17	9606.ENSP00000353874	0.902	Toll-like receptor 9
18	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
19	9606.ENSP00000304697	0.900	Polyubiquitin-B
20	9606.ENSP00000340944	0.900	Tyrosine-protein phosphatase non-receptor type 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.989	regulation of gene expression
GO:0060759	0.988	regulation of response to cytokine stimulus
GO:0048584	0.987	positive regulation of response to stimulus
GO:0007166	0.987	cell surface receptor signaling pathway
GO:0002376	0.984	immune system process
GO:0050778	0.983	positive regulation of immune response
GO:0001819	0.983	positive regulation of cytokine production
GO:0010033	0.982	response to organic substance
GO:0043123	0.982	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045088	0.980	regulation of innate immune response
GO:0051707	0.975	response to other organism
GO:0060760	0.975	positive regulation of response to cytokine stimulus
GO:0001959	0.968	regulation of cytokine-mediated signaling pathway
GO:0002221	0.968	pattern recognition receptor signaling pathway
GO:0032722	0.961	positive regulation of chemokine production
GO:0071216	0.960	cellular response to biotic stimulus
GO:0006909	0.940	phagocytosis
GO:0002224	0.934	toll-like receptor signaling pathway
GO:0071219	0.924	cellular response to molecule of bacterial origin
GO:0071310	0.923	cellular response to organic substance
GO:0009892	0.915	negative regulation of metabolic process
GO:0001961	0.911	positive regulation of cytokine-mediated signaling pathway
GO:0032496	0.879	response to lipopolysaccharide
GO:0048523	0.851	negative regulation of cellular process
GO:0010605	0.747	negative regulation of macromolecule metabolic process
GO:0002429	0.693	immune response-activating cell surface receptor signaling pathway
GO:0006950	0.677	response to stress
GO:0010629	0.588	negative regulation of gene expression
GO:1901701	0.576	cellular response to oxygen-containing compound
GO:0062207	0.560	regulation of pattern recognition receptor signaling pathway
GO:0034097	0.513	response to cytokine
GO:0051171	0.504	regulation of nitrogen compound metabolic process
GO:0071222	0.499	cellular response to lipopolysaccharide
GO:0002220	0.496	innate immune response activating cell surface receptor signaling pathway
GO:0048585	0.470	negative regulation of response to stimulus
GO:0006952	0.447	defense response
GO:0031323	0.437	regulation of cellular metabolic process
GO:0098542	0.436	defense response to other organism
GO:0010648	0.430	negative regulation of cell communication
GO:0062208	0.421	positive regulation of pattern recognition receptor signaling pathway
GO:0080090	0.351	regulation of primary metabolic process
GO:0023057	0.348	negative regulation of signaling
GO:0001818	0.312	negative regulation of cytokine production
GO:0009968	0.310	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005768	1.000	endosome
GO:0010008	0.911	endosome membrane
GO:0005783	0.726	endoplasmic reticulum
GO:0005829	0.584	cytosol
GO:0099503	0.432	secretory vesicle
GO:0030141	0.382	secretory granule
GO:0032991	0.373	protein-containing complex
GO:0030667	0.340	secretory granule membrane
GO:0005634	0.320	nucleus
GO:0001891	0.309	phagocytic cup

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]