StarFunc result for job id Q86XR8

User Input

>input (500 residues)
MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLA
YPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKN
EESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQT
HVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLET
NRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS
HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEEL
SEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK
YQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQL
LKDMQSIQNSLQSSSLCWDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86XR8	1.000	1.000	2.516E-66	500	1.000	1.000	Q86XR8.pdb.gz	CEP57_HUMAN Centrosomal protein of 57 kDa OS=Homo sapiens OX=9606 GN=CEP57 PE=1 SV=2
2	AFDB:Q8CEE0	0.453	0.453	1.988E-56	500	0.876	0.876	Q8CEE0.pdb.gz	CEP57_MOUSE Centrosomal protein of 57 kDa OS=Mus musculus OX=10090 GN=Cep57 PE=1 SV=2
3	AFDB:Q5FWP9	0.209	0.214	6.595E-20	488	0.330	0.338	Q5FWP9.pdb.gz	CE57L_XENLA Centrosomal protein cep57l1 OS=Xenopus laevis OX=8355 GN=cep57l1 PE=1 SV=1
4	AFDB:Q8IYX8	0.342	0.368	1.325E-17	460	0.308	0.335	Q8IYX8.pdb.gz	CE57L_HUMAN Centrosomal protein CEP57L1 OS=Homo sapiens OX=9606 GN=CEP57L1 PE=1 SV=1
5	AFDB:B9EJ80	0.173	0.078	2.630E-4	1147	0.080	0.035	B9EJ80.pdb.gz	PDZD8_MOUSE PDZ domain-containing protein 8 OS=Mus musculus OX=10090 GN=Pdzd8 PE=1 SV=1
6	AFDB:Q5DTU0	0.157	0.098	5.268E-4	825	0.068	0.041	Q5DTU0.pdb.gz	AF1L2_MOUSE Actin filament-associated protein 1-like 2 OS=Mus musculus OX=10090 GN=Afap1l2 PE=1 SV=2
7	AFDB:Q8N4X5	0.157	0.101	1.983E-3	818	0.064	0.039	Q8N4X5.pdb.gz	AF1L2_HUMAN Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2 PE=1 SV=1
8	AFDB:Q05021	0.146	0.126	2.113E-3	590	0.070	0.059	Q05021.pdb.gz	TAF7_YEAST Transcription initiation factor TFIID subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF7 PE=1 SV=1
9	AFDB:Q9UPV0	0.230	0.105	3.501E-3	1460	0.162	0.055	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	AFDB:E1BBG2	0.116	0.073	7.954E-3	853	0.094	0.055	E1BBG2.pdb.gz	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
11	PDB:1u2mC	0.144	0.466	1.705E-1	143	0.036	0.126	1u2mC.pdb.gz
12	PDB:7z37DP1	0.068	0.107	3.637E-1	273	0.052	0.095	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
13	PDB:1serB	0.129	0.153	6.420E-1	421	0.026	0.031	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
14	PDB:7enag	0.125	0.322	6.420E-1	166	0.058	0.175	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:4dk0A	0.118	0.168	6.838E-1	324	0.020	0.031	4dk0A.pdb.gz
16	PDB:2zdiB	0.142	0.653	8.264E-1	106	0.030	0.142	2zdiB.pdb.gz
17	PDB:3favC	0.139	0.639	9.376E-1	90	0.020	0.111	3favC.pdb.gz	WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
18	PDB:5bw9g	0.093	0.256	9.376E-1	141	0.026	0.092	5bw9g.pdb.gz
19	PDB:5ng5A	0.110	0.152	9.376E-1	340	0.014	0.021	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
20	PDB:5nikD	0.137	0.196	9.376E-1	340	0.020	0.029	5nikD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86XR8	0.0	1021	500	1.000	1.000	CEP57_HUMAN Centrosomal protein of 57 kDa OS=Homo sapiens OX=9606 GN=CEP57 PE=1 SV=2
2	Q8CEE0	0.0	832	500	0.856	0.856	CEP57_MOUSE Centrosomal protein of 57 kDa OS=Mus musculus OX=10090 GN=Cep57 PE=1 SV=2
3	Q5FWP9	9.20e-69	230	488	0.334	0.342	CE57L_XENLA Centrosomal protein cep57l1 OS=Xenopus laevis OX=8355 GN=cep57l1 PE=1 SV=1
4	Q8IYX8	6.35e-57	198	460	0.280	0.304	CE57L_HUMAN Centrosomal protein CEP57L1 OS=Homo sapiens OX=9606 GN=CEP57L1 PE=1 SV=1
5	Q6P2R3	7.63e-40	146	251	0.178	0.355	Q6P2R3_HUMAN C6orf182 protein OS=Homo sapiens OX=9606 GN=CEP57L1 PE=1 SV=1
6	Q9VCB8	0.093	38.1	1122	0.114	0.051	Q9VCB8_DROME Java no jive OS=Drosophila melanogaster OX=7227 GN=SMC6 PE=1 SV=1
7	Q60902	0.15	37.4	907	0.082	0.045	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
8	Q9UBC2	0.88	34.7	864	0.068	0.039	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
9	Q5JRA6	1.2	34.3	1907	0.110	0.029	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
10	P28023	2.8	33.1	1280	0.076	0.030	DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2
11	Q38B06	6.3	32.0	443	0.096	0.108	Q38B06_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0910 PE=4 SV=1
12	Q8K1N2	6.8	32.0	1249	0.068	0.027	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
13	A2AL36	6.9	32.0	2334	0.072	0.015	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
14	A7E2Y1	7.3	32.0	1983	0.066	0.017	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
15	Q9W1B0	9.0	31.6	1637	0.094	0.029	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
16	Q8DWM3	9.8	31.2	431	0.066	0.077	Q8DWM3_STRMU Secreted antigen GbpB/SagA putative peptidoglycan hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gbpB PE=4 SV=1
17	Q14203	10.0	31.6	1278	0.126	0.049	DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14073 Cep57_CLD	3.2e-61	218.0	Centrosome localisation domain of Cep57
2	PF06657 Cep57_MT_bd	2.6e-15	67.9	Centrosome microtubule-binding domain of Cep57
3	PF15168 TRIQK	4.5e+02	12.2	Triple QxxK/R motif-containing protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317902

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336524	0.910	Centrosomal protein of 63 kDa
2	9606.ENSP00000370337	0.797	Centrosomal protein of 152 kDa
3	9606.ENSP00000480791	0.776	Fibroblast growth factor 1
4	9606.ENSP00000451211	0.721	Protein NEDD1
5	9606.ENSP00000287598	0.715	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
6	9606.ENSP00000298050	0.677	Deuterosome assembly protein 1
7	9606.ENSP00000383820	0.673	Mesoderm induction early response protein 1
8	9606.ENSP00000355279	0.672	CCR4-NOT transcription complex subunit 7
9	9606.ENSP00000353458	0.668	Bromodomain adjacent to zinc finger domain protein 1A
10	9606.ENSP00000370021	0.666	Centlein
11	9606.ENSP00000379616	0.630	Myosin-11
12	9606.ENSP00000417638	0.629	Testis anion transporter 1
13	9606.ENSP00000411253	0.602	TBCC domain-containing protein 1
14	9606.ENSP00000265148	0.569	Centromere-associated protein E
15	9606.ENSP00000322390	0.564	Fibroblast growth factor 13
16	9606.ENSP00000366434	0.563	BRCA1-A complex subunit RAP80
17	9606.ENSP00000332592	0.548	Sperm-associated antigen 16 protein
18	9606.ENSP00000264498	0.537	Fibroblast growth factor 2
19	9606.ENSP00000166345	0.536	Pachytene checkpoint protein 2 homolog
20	9606.ENSP00000270861	0.534	Serine/threonine-protein kinase PLK4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.984	identical protein binding
GO:0042803	0.932	protein homodimerization activity
GO:0017134	0.843	fibroblast growth factor binding
GO:0015631	0.452	tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.960	response to stimulus
GO:0051716	0.933	cellular response to stimulus
GO:0071840	0.911	cellular component organization or biogenesis
GO:0023052	0.909	signaling
GO:0007154	0.908	cell communication
GO:0071774	0.908	response to fibroblast growth factor
GO:0016043	0.883	cellular component organization
GO:0007165	0.834	signal transduction
GO:0044344	0.694	cellular response to fibroblast growth factor stimulus
GO:0007167	0.691	enzyme-linked receptor protein signaling pathway
GO:0007169	0.664	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0022607	0.609	cellular component assembly
GO:0008543	0.479	fibroblast growth factor receptor signaling pathway
GO:0032501	0.365	multicellular organismal process
GO:0032502	0.358	developmental process
GO:0051259	0.315	protein complex oligomerization
GO:0051260	0.311	protein homooligomerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005813	1.000	centrosome
GO:0005829	0.983	cytosol
GO:0012505	0.925	endomembrane system
GO:0005634	0.924	nucleus
GO:0099080	0.859	supramolecular complex
GO:0099512	0.701	supramolecular fiber
GO:0099513	0.642	polymeric cytoskeletal fiber
GO:0005874	0.622	microtubule
GO:0070013	0.498	intracellular organelle lumen
GO:0031981	0.457	nuclear lumen
GO:0005794	0.401	Golgi apparatus
GO:0005654	0.391	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]