StarFunc result for job id Q86XX4

User Input

>input (1400 residues)
MGVLKVWLGLALALAEFAVLPHHSEGACVYQDSLLADATIWKPDSCQSCRCHGDIVICKP
AVCRNPQCAFEKGEVLQIAANQCCPECVLRTPGSCHHEKKIHEHGTEWASSPCSVCSCNH
GEVRCTPQPCPPLSCGHQELAFIPEGSCCPVCVGLGKPCSYEGHVFQDGEDWRLSRCAKC
LCRNGVAQCFTAQCQPLFCNQDETVVRVPGKCCPQCSARSCSAAGQVYEHGEQWSENACT
TCICDRGEVRCHKQACLPLRCGKGQSRARRHGQCCEECVSPAGSCSYDGVVRYQDEMWKG
SACEFCMCDHGQVTCQTGECAKVECARDEELIHLDGKCCPECISRNGYCVYEETGEFMSS
NASEVKRIPEGEKWEDGPCKVCECRGAQVTCYEPSCPPCPVGTLALEVKGQCCPDCTSVH
CHPDCLTCSQSPDHCDLCQDPTKLLQNGWCVHSCGLGFYQAGSLCLACQPQCSTCTSGLE
CSSCQPPLLMRHGQCVPTCGDGFYQDRHSCAVCHESCAGCWGPTEKHCLACRDPLHVLRD
GGCESSCGKGFYNRQGTCSACDQSCDSCGPSSPRCLTCTEKTVLHDGKCMSECPGGYYAD
ATGRCKVCHNSCASCSGPTPSHCTACSPPKALRQGHCLPRCGEGFYSDHGVCKACHSSCL
ACMGPAPSHCTGCKKPEEGLQVEQLSDVGIPSGECLAQCRAHFYLESTGICEACHQSCFR
CAGKSPHNCTDCGPSHVLLDGQCLSQCPDGYFHQEGSCTECHPTCRQCHGPLESDCISCY
PHISLTNGNCRTSCREEQFLNLVGYCADCHHLCQHCAADLHNTGSICLRCQNAHYLLLGD
HCVPDCPSGYYAERGACKKCHSSCRTCQGRGPFSCSSCDTNLVLSHTGTCSTTCFPGHYL
DDNHVCQPCNTHCGSCDSQASCTSCRDPNKVLLFGECQYESCAPQYYLDFSTNTCKECDW
SCSACSGPLKTDCLQCMDGYVLQDGACVEQCLSSFYQDSGLCKNCDSYCLQCQGPHECTR
CKGPFLLLEAQCVQECGKGYFADHAKHKCTACPQGCLQCSHRDRCHLCDHGFFLKSGLCV
YNCVPGFSVHTSNETCSGKIHTPSLHVNGSLILPIGSIKPLDFSLLNVQDQEGRVEDLLF
HVVSTPTNGQLVLSRNGKEVQLDKAGRFSWKDVNEKKVRFVHSKEKLRKGYLFLKISDQQ
FFSEPQLINIQAFSTQAPYVLRNEVLHISRGERATITTQMLDIRDDDNPQDVVIEIIDPP
LHGQLLQTLQSPATPIYQFQLDELSRGLLHYAHDGSDSTSDVAVLQANDGHSFHNILFQV
KTVPQNDRGLQLVANSMVWVPEGGMLQITNRILQAEAPGASAEEIIYKITQDYPQFGEVV
LLVNMPADSPADEGQHLPDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q04592	0.145	0.110	6.719E-46	1877	0.156	0.117	Q04592.pdb.gz	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
2	AFDB:Q92824	0.107	0.082	1.216E-44	1860	0.186	0.140	Q92824.pdb.gz	PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=4
3	AFDB:P30432	0.132	0.113	1.235E-32	1679	0.110	0.092	P30432.pdb.gz	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
4	AFDB:Q9NZV1	0.053	0.066	1.798E-19	1036	0.089	0.120	Q9NZV1.pdb.gz	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
5	AFDB:Q7T3Q2	0.061	0.079	4.366E-19	1027	0.087	0.119	Q7T3Q2.pdb.gz	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
6	AFDB:Q5H8B9	0.109	0.079	1.918E-17	2123	0.047	0.031	Q5H8B9.pdb.gz	FREM3_MOUSE FRAS1-related extracellular matrix protein 3 OS=Mus musculus OX=10090 GN=Frem3 PE=2 SV=2
7	AFDB:F1R4B2	0.116	0.081	7.787E-17	2167	0.049	0.031	F1R4B2.pdb.gz
8	AFDB:Q684R7	0.105	0.073	1.429E-16	2191	0.049	0.031	Q684R7.pdb.gz	FREM1_MOUSE FRAS1-related extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Frem1 PE=1 SV=1
9	AFDB:Q5H8C1	0.081	0.054	3.312E-16	2179	0.046	0.029	Q5H8C1.pdb.gz	FREM1_HUMAN FRAS1-related extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=FREM1 PE=1 SV=3
10	AFDB:Q6UVK1	0.110	0.073	9.696E-16	2322	0.040	0.024	Q6UVK1.pdb.gz	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
11	PDB:7mn8B	0.064	0.133	4.024E-5	579	0.061	0.147	7mn8B.pdb.gz
12	PDB:6velC	0.079	0.351	1.712E-4	209	0.021	0.144	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:7sqcO0	0.085	0.099	3.786E-4	1140	0.022	0.027	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:4aq1A	0.067	0.113	4.355E-4	721	0.024	0.046	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
15	PDB:3s3sA	0.061	0.113	7.628E-4	620	0.015	0.034	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
16	PDB:8dtlA	0.069	0.115	9.634E-4	741	0.062	0.117	8dtlA.pdb.gz
17	PDB:7sqcO1	0.065	0.115	1.009E-3	673	0.024	0.051	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6pxvA	0.083	0.115	1.161E-3	823	0.061	0.104	6pxvA.pdb.gz
19	PDB:6kzbC	0.057	0.096	2.452E-3	649	0.016	0.034	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
20	PDB:4n20A	0.069	0.121	3.732E-3	639	0.014	0.031	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQJ3	0.0	1359	4003	0.482	0.169	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
2	F1Q633	0.0	1288	3970	0.466	0.164	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
3	Q80T14	0.0	2386	4010	0.799	0.279	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
4	Q92824	1.08e-58	226	1860	0.176	0.133	PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=4
5	Q04592	5.10e-56	217	1877	0.148	0.110	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
6	P41413	1.64e-55	215	1809	0.155	0.120	PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus OX=10116 GN=Pcsk5 PE=2 SV=3
7	A0A669KA35	8.56e-54	210	1887	0.166	0.123	A0A669KA35_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=1
8	Q5JSG7	3.68e-53	207	1560	0.166	0.149	Q5JSG7_HUMAN Proprotein convertase subtilisin/kexin type 5 (Fragment) OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=1
9	P30432	2.04e-45	182	1679	0.119	0.099	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
10	O35171	5.16e-23	103	296	0.054	0.253	O35171_MOUSE PACE4 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=2 SV=1
11	H3BJL4	2.25e-21	103	798	0.054	0.094	H3BJL4_MOUSE Proprotein convertase subtilisin/kexin type 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
12	Q62030	2.52e-21	103	932	0.051	0.076	Q62030_MOUSE PACE4A (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=2 SV=1
13	E9Q4D0	2.62e-21	103	946	0.051	0.075	E9Q4D0_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=2
14	F6XJP7	3.14e-21	103	959	0.051	0.074	F6XJP7_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
15	Q3U492	6.04e-21	102	1550	0.089	0.081	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
16	Q63415	6.09e-21	102	937	0.051	0.076	PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus OX=10116 GN=Pcsk6 PE=1 SV=1
17	P29122	3.13e-18	93.6	969	0.046	0.067	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
18	Q8N8U9	3.28e-18	92.8	685	0.071	0.145	BMPER_HUMAN BMP-binding endothelial regulator protein OS=Homo sapiens OX=9606 GN=BMPER PE=1 SV=3
19	Q9GYX3	5.41e-18	92.4	751	0.059	0.111	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
20	Q9W2H2	6.48e-18	92.0	751	0.059	0.111	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16184 Cadherin_3	3.3e-38	141.4	Cadherin-like
2	PF00757 Furin-like	0.042	25.2	Furin-like cysteine rich region
3	PF15913 Furin-like_2	0.5	22.0	Furin-like repeat, cysteine-rich
4	PF14843 GF_recep_IV	3.3e-05	35.1	Growth factor receptor domain IV
5	PF03302 VSP	0.017	25.6	Giardia variant-specific surface protein
6	PF00093 VWC	3.2e-30	115.5	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000046968

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000009878	0.958	FRAS1 related extracellular matrix protein 2
2	9598.ENSPTRP00000003927	0.891	Belongs to the integrin alpha chain family.
3	9598.ENSPTRP00000049448	0.887	Uncharacterized protein
4	9598.ENSPTRP00000004110	0.865	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
5	9598.ENSPTRP00000002974	0.791	Uncharacterized protein
6	9598.ENSPTRP00000036737	0.781	Uncharacterized protein
7	9598.ENSPTRP00000056518	0.755	Glutamate receptor interacting protein 1
8	9598.ENSPTRP00000055001	0.733	Von Willebrand factor A domain containing 2
9	9598.ENSPTRP00000028078	0.707	Uncharacterized protein
10	9598.ENSPTRP00000052469	0.695	Uncharacterized protein
11	9598.ENSPTRP00000012100	0.681	Pan troglodytes Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) (LEO1), mRNA
12	9598.ENSPTRP00000028112	0.629	Pro-epidermal growth factor
13	9598.ENSPTRP00000012046	0.628	Uncharacterized protein
14	9598.ENSPTRP00000031080	0.628	Belongs to the protein kinase superfamily. Tyr protein kinase family
15	9598.ENSPTRP00000020449	0.620	Stonin 1
16	9598.ENSPTRP00000048194	0.598	Leucine-rich repeat containing G protein-coupled receptor 4
17	9598.ENSPTRP00000003094	0.597	Leucine-rich repeat containing G protein-coupled receptor 6
18	9598.ENSPTRP00000008874	0.597	Leucine-rich repeat containing G protein-coupled receptor 5
19	9598.ENSPTRP00000009804	0.597	Relaxin/insulin-like family peptide receptor 2
20	9598.ENSPTRP00000047055	0.597	Relaxin/insulin-like family peptide receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.367	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0032501	0.949	multicellular organismal process
GO:0048856	0.938	anatomical structure development
GO:0007275	0.910	multicellular organism development
GO:0048731	0.837	system development
GO:0048513	0.812	animal organ development
GO:0009888	0.802	tissue development
GO:0009653	0.660	anatomical structure morphogenesis
GO:0048736	0.603	appendage development
GO:0035107	0.568	appendage morphogenesis
GO:0009887	0.534	animal organ morphogenesis
GO:0065007	0.523	biological regulation
GO:0050789	0.514	regulation of biological process
GO:0009790	0.467	embryo development
GO:0050794	0.436	regulation of cellular process
GO:0048598	0.381	embryonic morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0062023	0.988	collagen-containing extracellular matrix
GO:0005622	0.329	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]