StarFunc result for job id Q86Y07

User Input

>input (508 residues)
MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVV
KVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMV
MERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPD
QVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCM
LRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY
DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
EKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI
SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLS
EETNADVYYYRIIIPVLLMLVFLALFFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y07	1.000	1.000	1.086E-88	508	1.000	1.000	Q86Y07.pdb.gz	VRK2_HUMAN Serine/threonine-protein kinase VRK2 OS=Homo sapiens OX=9606 GN=VRK2 PE=1 SV=3
2	AFDB:Q8BN21	0.698	0.705	3.720E-62	503	0.667	0.674	Q8BN21.pdb.gz	VRK2_MOUSE Serine/threonine-protein kinase VRK2 OS=Mus musculus OX=10090 GN=Vrk2 PE=1 SV=2
3	AFDB:Q7KRY6	0.603	0.514	2.024E-33	599	0.295	0.250	Q7KRY6.pdb.gz	NHK1_DROME Nucleosomal histone kinase 1 OS=Drosophila melanogaster OX=7227 GN=ball PE=1 SV=1
4	PDB:2rsvA	0.570	0.705	7.999E-32	403	0.348	0.439	2rsvA.pdb.gz
5	AFDB:Q19848	0.575	0.481	1.294E-30	610	0.219	0.182	Q19848.pdb.gz	VRK1_CAEEL Serine/threonine-protein kinase VRK1 OS=Caenorhabditis elegans OX=6239 GN=vrk-1 PE=1 SV=1
6	AFDB:A0A024QZI4	0.533	0.570	9.610E-30	474	0.224	0.241	A0A024QZI4.pdb.gz
7	AFDB:Q8K3G5	0.548	0.611	1.054E-28	453	0.226	0.254	Q8K3G5.pdb.gz	VRK3_MOUSE Inactive serine/threonine-protein kinase VRK3 OS=Mus musculus OX=10090 GN=Vrk3 PE=1 SV=2
8	AFDB:Q5XF24	0.469	0.507	3.510E-21	468	0.220	0.239	Q5XF24.pdb.gz	CKL13_ARATH Casein kinase 1-like protein 13 OS=Arabidopsis thaliana OX=3702 GN=CKL13 PE=2 SV=1
9	AFDB:Q9LW62	0.464	0.529	5.795E-21	442	0.205	0.235	Q9LW62.pdb.gz	CKL10_ARATH Casein kinase 1-like protein 10 OS=Arabidopsis thaliana OX=3702 GN=CKL10 PE=2 SV=1
10	AFDB:Q9LSX4	0.463	0.488	1.069E-20	480	0.219	0.231	Q9LSX4.pdb.gz	CKL8_ARATH Casein kinase 1-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=CKL8 PE=2 SV=1
11	AFDB:Q556Y4	0.475	0.561	1.413E-20	426	0.224	0.268	Q556Y4.pdb.gz	KC1_DICDI Casein kinase I OS=Dictyostelium discoideum OX=44689 GN=cak1-1 PE=1 SV=1
12	PDB:6gzdA	0.469	0.781	8.405E-20	297	0.173	0.296	6gzdA.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
13	PDB:6pxnA	0.421	0.708	2.049E-19	290	0.177	0.310	6pxnA.pdb.gz
14	PDB:2bujA	0.422	0.684	1.047E-13	291	0.106	0.186	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
15	PDB:4c0tA	0.381	0.624	9.717E-13	291	0.112	0.196	4c0tA.pdb.gz
16	PDB:7myjC	0.374	0.404	2.960E-12	465	0.130	0.142	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:6qx9K	0.363	0.541	5.462E-12	322	0.087	0.137	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:4krcA	0.350	0.565	6.455E-12	297	0.091	0.155	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:6b1uA	0.395	0.446	1.127E-11	442	0.108	0.124	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:3pvuA	0.423	0.357	1.488E-11	609	0.114	0.095	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86Y07	0.0	1059	508	1.000	1.000	VRK2_HUMAN Serine/threonine-protein kinase VRK2 OS=Homo sapiens OX=9606 GN=VRK2 PE=1 SV=3
2	Q8BN21	0.0	714	503	0.695	0.702	VRK2_MOUSE Serine/threonine-protein kinase VRK2 OS=Mus musculus OX=10090 GN=Vrk2 PE=1 SV=2
3	Q80X41	7.25e-119	358	440	0.400	0.461	VRK1_MOUSE Serine/threonine-protein kinase VRK1 OS=Mus musculus OX=10090 GN=Vrk1 PE=1 SV=2
4	Q99986	3.14e-116	350	396	0.343	0.439	VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1
5	H0YJF7	4.06e-116	350	420	0.343	0.414	H0YJF7_HUMAN VRK serine/threonine kinase 1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=2
6	H0YJJ9	1.18e-115	348	394	0.343	0.442	H0YJJ9_HUMAN VRK serine/threonine kinase 1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=2
7	P16913	5.07e-69	225	300	0.238	0.403	PG187_VACCW B1 kinase OS=Vaccinia virus (strain Western Reserve) OX=10254 GN=OPG187 PE=1 SV=1
8	Q7KRY6	5.45e-68	231	599	0.272	0.230	NHK1_DROME Nucleosomal histone kinase 1 OS=Drosophila melanogaster OX=7227 GN=ball PE=1 SV=1
9	Q8K3G5	1.01e-58	202	453	0.230	0.258	VRK3_MOUSE Inactive serine/threonine-protein kinase VRK3 OS=Mus musculus OX=10090 GN=Vrk3 PE=1 SV=2
10	Q8IV63	1.44e-56	197	474	0.236	0.253	VRK3_HUMAN Inactive serine/threonine-protein kinase VRK3 OS=Homo sapiens OX=9606 GN=VRK3 PE=1 SV=2
11	M0QYA8	7.08e-54	188	406	0.201	0.251	M0QYA8_HUMAN VRK serine/threonine kinase 3 OS=Homo sapiens OX=9606 GN=VRK3 PE=1 SV=1
12	Q19848	1.34e-47	176	610	0.219	0.182	VRK1_CAEEL Serine/threonine-protein kinase VRK1 OS=Caenorhabditis elegans OX=6239 GN=vrk-1 PE=1 SV=1
13	Q9ZUP4	1.16e-30	125	433	0.191	0.224	CKL5_ARATH Casein kinase 1-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=CKL5 PE=1 SV=1
14	Q20471	7.32e-30	124	497	0.199	0.203	KIN20_CAEEL Casein kinase I isoform delta OS=Caenorhabditis elegans OX=6239 GN=kin-20 PE=1 SV=3
15	Q5BP74	9.67e-30	122	415	0.201	0.246	KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis OX=8355 GN=csnk1d PE=1 SV=2
16	Q9JJ76	1.83e-29	122	416	0.201	0.245	Q9JJ76_RAT Casein kinase 1 epsilon OS=Rattus norvegicus OX=10116 GN=Csnk1e PE=1 SV=1
17	P49674	1.99e-29	122	416	0.201	0.245	KC1E_HUMAN Casein kinase I isoform epsilon OS=Homo sapiens OX=9606 GN=CSNK1E PE=1 SV=1
18	A0A8I5ZYG3	2.05e-29	122	416	0.201	0.245	A0A8I5ZYG3_RAT Casein kinase 1, epsilon OS=Rattus norvegicus OX=10116 GN=Csnk1e PE=3 SV=1
19	Q9JMK2	2.09e-29	122	416	0.201	0.245	KC1E_MOUSE Casein kinase I isoform epsilon OS=Mus musculus OX=10090 GN=Csnk1e PE=1 SV=2
20	P35508	2.27e-29	122	415	0.201	0.246	KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus OX=9913 GN=CSNK1D PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.6	17.8	ABC1 atypical kinase-like domain
2	PF14531 Kinase-like	50	14.7	Kinase-like
3	PF00069 Pkinase	6.9e-15	66.7	Protein kinase domain
4	PF17667 Pkinase_fungal	1.6	19.1	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	1.3e-07	42.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408002

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310275	0.957	Barrier-to-autointegration factor
2	9606.ENSP00000308369	0.937	Inner nuclear membrane protein Man1
3	9606.ENSP00000358857	0.924	Emerin
4	9606.ENSP00000266732	0.907	Lamina-associated polypeptide 2, isoform alpha
5	9606.ENSP00000216629	0.901	B1 bradykinin receptor
6	9606.ENSP00000293760	0.900	LEM domain-containing protein 2
7	9606.ENSP00000381958	0.868	Kinase suppressor of Ras 1
8	9606.ENSP00000350686	0.765	Ankyrin repeat and LEM domain-containing protein 2
9	9606.ENSP00000226004	0.668	Dual specificity protein phosphatase 3
10	9606.ENSP00000303252	0.661	Zinc finger protein 804A
11	9606.ENSP00000304078	0.604	Protein FAM83B
12	9606.ENSP00000302564	0.590	Bcl-2-like protein 1
13	9606.ENSP00000381070	0.589	Dual specificity mitogen-activated protein kinase kinase 7
14	9606.ENSP00000241014	0.578	C-Jun-amino-terminal kinase-interacting protein 1
15	9606.ENSP00000373647	0.566	Protein FAM83G
16	9606.ENSP00000283109	0.565	Serine/threonine-protein kinase RIO2
17	9606.ENSP00000417185	0.563	Von Willebrand factor A domain-containing protein 1
18	9606.ENSP00000400839	0.562	Solute carrier family 35 member G2
19	9606.ENSP00000358335	0.557	Mitogen-activated protein kinase kinase kinase 7
20	9606.ENSP00000263125	0.556	Protein kinase C theta type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019901	0.996	protein kinase binding
GO:0019904	0.890	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0006468	0.988	protein phosphorylation
GO:0050789	0.979	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0046777	0.898	protein autophosphorylation
GO:0050896	0.723	response to stimulus
GO:0051716	0.483	cellular response to stimulus
GO:0048583	0.456	regulation of response to stimulus
GO:0019222	0.430	regulation of metabolic process
GO:0048518	0.381	positive regulation of biological process
GO:0060255	0.342	regulation of macromolecule metabolic process
GO:0080090	0.333	regulation of primary metabolic process
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0009966	0.319	regulation of signal transduction
GO:0006950	0.302	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0012505	0.994	endomembrane system
GO:0016020	0.991	membrane
GO:0032991	0.966	protein-containing complex
GO:0005783	0.966	endoplasmic reticulum
GO:0005829	0.869	cytosol
GO:0031975	0.853	envelope
GO:0031967	0.823	organelle envelope
GO:0043232	0.676	intracellular non-membrane-bounded organelle
GO:0070013	0.547	intracellular organelle lumen
GO:0031090	0.537	organelle membrane
GO:0031981	0.505	nuclear lumen
GO:0005654	0.430	nucleoplasm
GO:0031984	0.409	organelle subcompartment
GO:0042175	0.369	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.306	endoplasmic reticulum subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]