StarFunc result for job id Q86Y13

User Input

>input (1208 residues)
MDSLPDEFFVRHPAVEDQRKEETENKLEKSSGQLNKQENDIPTDLVPVNLLLEVKKLLNA
INTLPKGVVPHIKKFLQEDFSFQTMQREVAANSQNGEEIVPALTLRFLITQLEAALRNIQ
AGNYTAHQINIGYYLTLLFLYGVALTERGKKEDYTEAENKFLVMKMMIQENEICENFMSL
VYFGRGLLRCAQKRYNGGLLEFHKSLQEIGDKNDHWFDIDPTEDEDLPTTFKDLLNNFIK
TTESNIMKQTICSYLDCERSCEADILKNTSYKGFFQLMCSKSCCVYFHKICWKKFKNLKY
PGENDQSFSGKKCLKEGCTGDMVRMLQCDVPGIVKILFEVVRKDEYITIENLGASYRKLI
SLKITDTDIRPKISLKFNTKDEMPIFKLDYNYFYHLLHIIIISGTDIVRQIFDEAMPPPL
LKKELLIHKNVLESYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVF
PAPKKGWNMEPPSSDISKSADILRLCKYRDILLSEILMNGLTESQFNSIWKKVSDILLRL
GMMQEDIDKVKENPIENISLDYHQLSVYLGIPVPEIIQRMLSCYQQGIALQSITGSQRIE
IEELQNEEEELSPPLMEYNINVKSHPEIQFAEINKDGTSIPSESSTESLKDLQEVKSKQR
KKKKTKNKKNKDSKEDQVPYVVEKEEQLRKEQANPHSVSRLIKDDASDVQEDSAMEDKFY
SLDELHILDMIEQGSAGKVTTDYGETEKERLARQRQLYKLHYQCEDFKRQLRTVTFRWQE
NQMQIKKKDKIIASLNQQVAFGINKVSKLQRQIHAKDNEIKNLKEQLSMKRSQWEMEKHN
LESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNL
ESLQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQGFALSTLPPVQLPPPPPSPEI
LMQQFLGRPLVKESFFRPILTVPQMPAVCPGVVSATGQPRAPLMTGIAWALPAPVGDAVP
PSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAYGKSLSELTFDEIVCKI
SQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPAWRPLTSQGPATWEGASNPDE
EEEEEEPCVICHENLSPENLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFPGH
PSRQLPKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y13	1.000	1.000	0.000	1208	1.000	1.000	Q86Y13.pdb.gz	DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens OX=9606 GN=DZIP3 PE=1 SV=2
2	AFDB:Q4GYP6	0.084	0.103	4.024E-4	911	0.075	0.099	Q4GYP6.pdb.gz	Q4GYP6_TRYB2 BRO1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3270 PE=4 SV=1
3	AFDB:X2JDY8	0.056	0.061	4.207E-4	1025	0.069	0.081	X2JDY8.pdb.gz	RHGF_DROME Rho GTPase-activating protein Graf OS=Drosophila melanogaster OX=7227 GN=Graf PE=1 SV=1
4	AFDB:Q9H3S7	0.076	0.060	2.184E-3	1636	0.075	0.055	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
5	AFDB:Q8TDY2	0.054	0.043	2.729E-3	1594	0.101	0.077	Q8TDY2.pdb.gz	RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1 PE=1 SV=3
6	AFDB:Q09933	0.077	0.092	3.261E-3	882	0.102	0.139	Q09933.pdb.gz	DIS1_SCHPO Phosphoprotein p93 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis1 PE=1 SV=1
7	AFDB:Q9QZA2	0.087	0.114	5.090E-3	873	0.057	0.079	Q9QZA2.pdb.gz	PDC6I_RAT Programmed cell death 6-interacting protein OS=Rattus norvegicus OX=10116 GN=Pdcd6ip PE=1 SV=2
8	AFDB:Q8RWQ4	0.052	0.070	1.085E-2	870	0.113	0.157	Q8RWQ4.pdb.gz	RGAP7_ARATH Rho GTPase-activating protein 7 OS=Arabidopsis thaliana OX=3702 GN=ROPGAP7 PE=2 SV=1
9	PDB:7mexA	0.060	0.047	2.858E-2	1737	0.062	0.043	7mexA.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
10	AFDB:Q9FMP8	0.065	0.081	4.714E-2	827	0.111	0.162	Q9FMP8.pdb.gz	RGAP6_ARATH Rho GTPase-activating protein 6 OS=Arabidopsis thaliana OX=3702 GN=ROPGAP6 PE=2 SV=1
11	PDB:1ihgA	0.085	0.253	1.242E-1	364	0.022	0.071	1ihgA.pdb.gz
12	PDB:7obqu	0.093	0.209	1.622E-1	441	0.040	0.109	7obqu.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
13	PDB:4kvmB	0.086	0.122	1.774E-1	722	0.056	0.094	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
14	PDB:4mt6A	0.067	0.128	1.774E-1	389	0.029	0.090	4mt6A.pdb.gz
15	PDB:5a31B	0.042	0.475	1.854E-1	84	0.017	0.250	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:6yxyBE	0.081	0.205	1.854E-1	407	0.029	0.086	6yxyBE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
17	AFDB:A2ARP9	0.077	0.131	2.049E-1	588	0.076	0.156	A2ARP9.pdb.gz	CTSR2_MOUSE Cation channel sperm-associated protein 2 OS=Mus musculus OX=10090 GN=Catsper2 PE=1 SV=2
18	PDB:8a3tU	0.044	0.366	2.119E-1	114	0.017	0.175	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
19	PDB:5jheA	0.090	0.236	2.422E-1	388	0.017	0.052	5jheA.pdb.gz
20	PDB:7qe7K	0.090	0.167	2.768E-1	531	0.041	0.094	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86Y13	0.0	2508	1208	1.000	1.000	DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens OX=9606 GN=DZIP3 PE=1 SV=2
2	O88196	6.06e-26	119	1979	0.103	0.063	TTC3_MOUSE E3 ubiquitin-protein ligase TTC3 OS=Mus musculus OX=10090 GN=Ttc3 PE=1 SV=2
3	P53804	1.76e-21	104	2025	0.098	0.058	TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens OX=9606 GN=TTC3 PE=1 SV=2
4	Q9M2S6	4.34e-10	64.3	273	0.031	0.139	SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana OX=3702 GN=SDIR1 PE=1 SV=1
5	Q95SP2	1.18e-09	65.1	626	0.020	0.038	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
6	Q06003	1.23e-09	64.3	461	0.022	0.059	GOLI_DROME E3 ubiquitin-protein ligase goliath OS=Drosophila melanogaster OX=7227 GN=gol PE=1 SV=3
7	Q9LW77	7.62e-09	62.0	492	0.022	0.053	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
8	Q3U2C5	1.59e-08	60.8	394	0.022	0.066	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
9	Q8ILM8	1.81e-08	60.8	510	0.022	0.051	Q8ILM8_PLAF7 ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1422500 PE=4 SV=2
10	Q6NPT7	2.83e-08	60.1	460	0.020	0.052	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
11	Q8NC42	3.48e-08	59.7	400	0.020	0.060	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
12	H6TS39	3.72e-08	58.5	280	0.021	0.089	H6TS39_MAIZE Ring finger protein OS=Zea mays OX=4577 GN=RFP1 PE=2 SV=1
13	Q86TM6	5.03e-08	59.7	617	0.020	0.039	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
14	Q9DBY1	7.35e-08	59.3	612	0.020	0.039	SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus OX=10090 GN=Syvn1 PE=1 SV=3
15	A5WWA0	9.90e-08	58.9	868	0.019	0.026	ZNRF3_DANRE E3 ubiquitin-protein ligase znrf3 OS=Danio rerio OX=7955 GN=znrf3 PE=1 SV=2
16	Q9ULK6	1.04e-07	58.2	438	0.017	0.048	RN150_HUMAN RING finger protein 150 OS=Homo sapiens OX=9606 GN=RNF150 PE=1 SV=2
17	Q7XTV7	1.58e-07	58.2	667	0.019	0.034	HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica OX=39947 GN=HIP1 PE=1 SV=2
18	Q5SSZ7	1.77e-07	58.2	913	0.020	0.026	ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus OX=10090 GN=Znrf3 PE=1 SV=1
19	Q14B02	2.24e-07	57.0	382	0.022	0.068	RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus OX=10090 GN=Rnf133 PE=1 SV=1
20	Q08D68	2.89e-07	57.4	853	0.021	0.029	ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis OX=8364 GN=znrf3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18738 HEPN_DZIP3	3.1e-27	106.6	DZIP3/ hRUL138-like HEPN
2	PF19179 TTC3_DZIP3_dom	1.4e-14	65.2	E3 ubiquitin-protein ligase TTC3/DZIP3 domain
3	PF12861 zf-ANAPC11	19	16.7	Anaphase-promoting complex subunit 11 RING-H2 finger
4	PF00097 zf-C3HC4	0.015	26.5	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	0.0018	29.4	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.0076	27.4	Zinc finger, C3HC4 type (RING finger)
7	PF12678 zf-rbx1	4.3e-05	35.0	RING-H2 zinc finger domain
8	PF17123 zf-RING_11	0.61	21.2	RING-like zinc finger
9	PF17120 zf-RING_16	99	14.0	RING/Ubox like zinc-binding domain
10	PF13639 zf-RING_2	3.5e-06	38.6	Ring finger domain
11	PF14634 zf-RING_5	0.72	21.2	zinc-RING finger domain
12	PF13445 zf-RING_UBOX	4.9	18.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355028

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344674	0.920	Dehydrogenase/reductase SDR family member 2, mitochondrial
2	9606.ENSP00000268712	0.846	Nuclear receptor corepressor 1
3	9606.ENSP00000329918	0.772	RNA-binding protein MEX3B
4	9606.ENSP00000325690	0.747	Histone-arginine methyltransferase CARM1
5	9606.ENSP00000244769	0.745	Ataxin-1
6	9606.ENSP00000379931	0.721	Ubiquitin-conjugating enzyme E2 E2
7	9606.ENSP00000454852	0.716	Snurportin-1
8	9606.ENSP00000232603	0.694	MORC family CW-type zinc finger protein 1
9	9606.ENSP00000350402	0.684	HERV-H LTR-associating protein 2
10	9606.ENSP00000414109	0.672	Holliday junction recognition protein
11	9606.ENSP00000375863	0.666	Heterogeneous nuclear ribonucleoprotein U-like protein 1
12	9606.ENSP00000260363	0.654	Kinesin-like protein KIF23
13	9606.ENSP00000265970	0.650	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
14	9606.ENSP00000320184	0.622	Mitochondrial ribosomal protein S23
15	9606.ENSP00000295746	0.613	Protein CIP2A
16	9606.ENSP00000273353	0.595	Myosin-15
17	9606.ENSP00000264538	0.593	Intraflagellar transport protein 57 homolog
18	9606.ENSP00000001008	0.568	Peptidyl-prolyl cis-trans isomerase FKBP4
19	9606.ENSP00000263925	0.568	E3 ubiquitin-protein ligase LNX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0003723	0.997	RNA binding
GO:0031593	0.996	polyubiquitin modification-dependent protein binding
GO:0019902	0.989	phosphatase binding
GO:0061659	0.336	ubiquitin-like protein ligase activity
GO:0061630	0.333	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0032446	0.980	protein modification by small protein conjugation
GO:0000209	0.965	protein polyubiquitination
GO:0050789	0.701	regulation of biological process
GO:0050794	0.631	regulation of cellular process
GO:0009987	0.478	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.967	nuclear lumen
GO:0005654	0.962	nucleoplasm
GO:0005829	0.949	cytosol
GO:0016020	0.707	membrane
GO:0012505	0.368	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]