StarFunc result for job id Q86Y37

User Input

>input (369 residues)
MEESMEEEEGGSYEAMMDDQNHNNWEAAVDGFRQPLPPPPPPSSIPAPAREPPGGQLLAV
PAVSVDRKGPKEGLPMGPQPPPEANGVIMMLKSCDAAAAVAKAAPAPTASSTININTSTS
KFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMY
SDLIKKITNHLERVSKELQASPPDLYIERFNIALGQYMGALQSIVPLFIYMNKFYIETKL
NRDLKDDLIKLFTEHVAEKHIYSLMPLLLEAQSTPFQVTPSTMANIVKGLYTLRPEWVQM
APTLFSKFIPNILPPAVESELSEYAAQDQKFQRELIQNGFTRGDQSRKRAGDELAYNSSS
ACASSRGYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y37	1.000	1.000	1.840E-47	369	1.000	1.000	Q86Y37.pdb.gz	CACL1_HUMAN CDK2-associated and cullin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACUL1 PE=1 SV=1
2	AFDB:Q17392	0.378	0.177	6.046E-5	840	0.111	0.049	Q17392.pdb.gz	CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans OX=6239 GN=cul-4 PE=1 SV=3
3	PDB:5n4wA	0.397	0.231	2.432E-3	671	0.073	0.040	5n4wA.pdb.gz	Crystal Structure of the Cul2-Rbx1-EloBC-VHL Ubiquitin Ligase Complex.
4	PDB:6v9iC	0.381	0.207	4.102E-3	730	0.073	0.037	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
5	PDB:6ttuC	0.368	0.208	5.720E-3	701	0.084	0.044	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
6	AFDB:Q3UFM5	0.122	0.068	1.179E-2	854	0.154	0.067	Q3UFM5.pdb.gz	NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nom1 PE=1 SV=2
7	AFDB:Q9VC94	0.133	0.056	1.296E-2	1430	0.100	0.026	Q9VC94.pdb.gz	Q9VC94_DROME LD41803p OS=Drosophila melanogaster OX=7227 GN=Rrp5 PE=1 SV=2
8	AFDB:Q8NEN0	0.150	0.075	2.185E-2	867	0.100	0.043	Q8NEN0.pdb.gz	ARMC2_HUMAN Armadillo repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=ARMC2 PE=1 SV=4
9	AFDB:Q9VDS9	0.143	0.055	4.673E-2	1363	0.138	0.037	Q9VDS9.pdb.gz	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
10	AFDB:P53367	0.123	0.122	4.900E-2	373	0.127	0.126	P53367.pdb.gz	ARFP1_HUMAN Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1 PE=1 SV=2
11	AFDB:P22674	0.107	0.111	5.138E-2	350	0.152	0.160	P22674.pdb.gz	CCNO_HUMAN Cyclin-O OS=Homo sapiens OX=9606 GN=CCNO PE=1 SV=2
12	AFDB:Q0KHQ5	0.097	0.040	6.214E-2	1039	0.163	0.058	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
13	AFDB:O61345	0.104	0.065	9.528E-2	737	0.160	0.080	O61345.pdb.gz	PENG_DROME Protein penguin OS=Drosophila melanogaster OX=7227 GN=peng PE=2 SV=1
14	PDB:6gn0A	0.134	0.181	1.923E-1	239	0.073	0.113	6gn0A.pdb.gz
15	PDB:5mqfT	0.146	0.141	2.016E-1	395	0.054	0.051	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
16	PDB:6n3qF	0.105	0.169	2.016E-1	190	0.103	0.200	6n3qF.pdb.gz
17	PDB:6jhoA	0.084	0.125	2.217E-1	200	0.057	0.105	6jhoA.pdb.gz
18	PDB:6r6hO	0.384	0.209	2.325E-1	745	0.098	0.048	6r6hO.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
19	PDB:7u6fD1	0.118	0.080	2.438E-1	733	0.103	0.052	7u6fD1.pdb.gz
20	PDB:3axyC	0.143	0.191	3.565E-1	235	0.057	0.089	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86Y37	0.0	765	369	1.000	1.000	CACL1_HUMAN CDK2-associated and cullin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACUL1 PE=1 SV=1
2	Q9ZVH4	9.74e-10	62.4	732	0.095	0.048	CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana OX=3702 GN=CUL3A PE=1 SV=1
3	Q9C9L0	3.03e-08	57.8	732	0.100	0.051	CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana OX=3702 GN=CUL3B PE=1 SV=1
4	Q13618	1.05e-06	53.1	768	0.073	0.035	CUL3_HUMAN Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 PE=1 SV=2
5	B5DF89	1.07e-06	53.1	768	0.073	0.035	CUL3_RAT Cullin-3 OS=Rattus norvegicus OX=10116 GN=Cul3 PE=1 SV=2
6	Q9JLV5	1.16e-06	52.8	768	0.073	0.035	CUL3_MOUSE Cullin-3 OS=Mus musculus OX=10090 GN=Cul3 PE=1 SV=1
7	Q8IP45	7.46e-06	50.4	934	0.070	0.028	Q8IP45_DROME Cullin 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=2
8	Q9V475	1.21e-05	49.7	773	0.070	0.034	Q9V475_DROME Cullin 3, isoform C OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=1
9	Q17391	0.003	42.0	777	0.065	0.031	CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans OX=6239 GN=cul-3 PE=1 SV=2
10	U4PBY0	0.076	37.7	4185	0.092	0.008	U4PBY0_CAEEL HECT-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=eel-1 PE=1 SV=1
11	Q9GUP2	0.078	37.7	4177	0.092	0.008	Q9GUP2_CAEEL HECT-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=eel-1 PE=1 SV=2
12	Q5BI50	0.39	35.4	821	0.111	0.050	Q5BI50_DROME Cullin 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=1 SV=1
13	M9PC48	2.5	32.7	18095	0.049	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PCJ6	2.5	32.7	18641	0.049	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB30	4.1	32.3	22949	0.049	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
16	M9PBZ0	4.1	32.3	22830	0.049	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PC41	4.1	32.3	22743	0.049	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC45	4.1	32.3	22300	0.049	0.001	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PEH5	4.1	32.3	20710	0.049	0.001	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PEI1	4.1	32.3	21657	0.049	0.001	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00888 Cullin	1.3e-08	45.7	Cullin family
2	PF14966 DNA_repr_REX1B	2.7e+02	13.6	DNA repair REX1-B
3	PF04637 Herpes_pp85	26	14.7	Herpesvirus phosphoprotein 85 (HHV6-7 U14/HCMV UL25)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358147

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.849	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000376167	0.767	COP9 signalosome complex subunit 1
3	9606.ENSP00000419740	0.736	5-methylcytosine rRNA methyltransferase NSUN4
4	9606.ENSP00000348056	0.717	SUMO-conjugating enzyme UBC9
5	9606.ENSP00000299259	0.711	COP9 signalosome complex subunit 2
6	9606.ENSP00000244426	0.691	F-box only protein 9
7	9606.ENSP00000358089	0.690	Nucleolysin TIAR
8	9606.ENSP00000361001	0.685	EF-hand calcium-binding domain-containing protein 14
9	9606.ENSP00000370194	0.683	GDP-mannose 4,6 dehydratase
10	9606.ENSP00000350512	0.662	COP9 signalosome complex subunit 5
11	9606.ENSP00000301764	0.649	DNA damage-binding protein 1
12	9606.ENSP00000430774	0.649	Uncharacterized protein
13	9606.ENSP00000419126	0.642	Uncharacterized protein C10orf88
14	9606.ENSP00000442318	0.624	Cullin-associated NEDD8-dissociated protein 1
15	9606.ENSP00000478121	0.624	Elongin-C
16	9606.ENSP00000349957	0.610	Anaphase promoting complex subunit 11
17	9606.ENSP00000376609	0.585	G protein-coupled receptor kinase 5
18	9606.ENSP00000298510	0.579	Thioredoxin-dependent peroxide reductase, mitochondrial
19	9606.ENSP00000387641	0.568	Cullin-associated NEDD8-dissociated protein 2
20	9606.ENSP00000264389	0.562	COP9 signalosome complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051246	0.983	regulation of protein metabolic process
GO:0051173	0.981	positive regulation of nitrogen compound metabolic process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0031399	0.973	regulation of protein modification process
GO:0050790	0.959	regulation of catalytic activity
GO:0031401	0.948	positive regulation of protein modification process
GO:0048522	0.944	positive regulation of cellular process
GO:0051174	0.942	regulation of phosphorus metabolic process
GO:0044093	0.934	positive regulation of molecular function
GO:0031325	0.922	positive regulation of cellular metabolic process
GO:0051338	0.913	regulation of transferase activity
GO:0044772	0.909	mitotic cell cycle phase transition
GO:0043085	0.889	positive regulation of catalytic activity
GO:0019220	0.877	regulation of phosphate metabolic process
GO:0051347	0.874	positive regulation of transferase activity
GO:0042325	0.860	regulation of phosphorylation
GO:0010562	0.805	positive regulation of phosphorus metabolic process
GO:0045937	0.798	positive regulation of phosphate metabolic process
GO:0042327	0.793	positive regulation of phosphorylation
GO:0000082	0.786	G1/S transition of mitotic cell cycle
GO:0001932	0.735	regulation of protein phosphorylation
GO:0033674	0.731	positive regulation of kinase activity
GO:0071704	0.724	organic substance metabolic process
GO:0044238	0.718	primary metabolic process
GO:0006807	0.701	nitrogen compound metabolic process
GO:0001934	0.698	positive regulation of protein phosphorylation
GO:0043170	0.665	macromolecule metabolic process
GO:0019538	0.603	protein metabolic process
GO:0044237	0.517	cellular metabolic process
GO:0044260	0.434	cellular macromolecule metabolic process
GO:0042127	0.405	regulation of cell population proliferation
GO:0043412	0.386	macromolecule modification
GO:0036211	0.379	protein modification process
GO:0050896	0.346	response to stimulus
GO:0045859	0.341	regulation of protein kinase activity
GO:0045860	0.313	positive regulation of protein kinase activity
GO:0008284	0.308	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:1902494	0.923	catalytic complex
GO:0140535	0.906	intracellular protein-containing complex
GO:1990234	0.906	transferase complex
GO:0000151	0.857	ubiquitin ligase complex
GO:0031461	0.658	cullin-RING ubiquitin ligase complex
GO:0016020	0.328	membrane
GO:0043232	0.305	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]