StarFunc result for job id Q86Y38

User Input

>input (959 residues)
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPA
PAPRRERRDLPAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARA
LDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHAR
KTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRF
CPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHV
DKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFI
NLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGD
RRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSP
HCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF
EAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGL
RRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVM
PKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTV
TVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVA
PLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGT
ALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q811B1	0.803	0.808	0.000	953	0.888	0.894	Q811B1.pdb.gz	XYLT1_MOUSE Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1
2	AFDB:Q86Y38	1.000	1.000	0.000	959	1.000	1.000	Q86Y38.pdb.gz	XYLT1_HUMAN Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
3	AFDB:Q7KVA1	0.664	0.725	7.226E-78	876	0.315	0.345	Q7KVA1.pdb.gz	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
4	PDB:2gamC	0.247	0.607	4.579E-16	374	0.075	0.193	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
5	PDB:6fxrA	0.136	0.172	2.251E-4	700	0.064	0.087	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
6	PDB:7msnA	0.107	0.220	7.152E-4	417	0.020	0.046	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
7	PDB:4y63A	0.150	0.421	7.984E-4	282	0.029	0.099	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
8	PDB:1jv1A	0.144	0.248	1.726E-3	490	0.032	0.063	1jv1A.pdb.gz	Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
9	PDB:4d0tA	0.130	0.237	1.726E-3	496	0.030	0.058	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
10	PDB:4d11C	0.121	0.246	2.151E-3	436	0.033	0.073	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
11	PDB:7x8kB	0.110	0.251	2.272E-3	367	0.020	0.052	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
12	PDB:2i5kB	0.133	0.235	2.537E-3	466	0.028	0.058	2i5kB.pdb.gz
13	PDB:7d72A	0.132	0.272	3.730E-3	407	0.027	0.064	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
14	AFDB:P06701	0.058	0.058	1.022E-1	978	0.080	0.079	P06701.pdb.gz	SIR3_YEAST Regulatory protein SIR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIR3 PE=1 SV=6
15	AFDB:Q9VEH0	0.041	0.046	1.152	842	0.053	0.061	Q9VEH0.pdb.gz	Q9VEH0_DROME Aluminum tubes, isoform A OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
16	AFDB:B7SY83	0.041	0.031	1.286	1477	0.071	0.046	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
17	AFDB:O60177	0.057	0.055	1.359	1040	0.062	0.057	O60177.pdb.gz	YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC23E6.02 PE=3 SV=1
18	AFDB:Q7Z6P3	0.074	0.071	1.997	1021	0.081	0.076	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
19	AFDB:P87323	0.054	0.085	2.230	522	0.065	0.119	P87323.pdb.gz	MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcs4 PE=4 SV=1
20	AFDB:O64728	0.055	0.045	2.779	1218	0.060	0.048	O64728.pdb.gz	STI_ARATH Protein STICHEL OS=Arabidopsis thaliana OX=3702 GN=STI PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3J0E7	0.0	1314	919	0.656	0.684	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
2	Q811B1	0.0	1677	953	0.877	0.882	XYLT1_MOUSE Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1
3	Q86Y38	0.0	2001	959	1.000	1.000	XYLT1_HUMAN Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
4	Q9EPI1	0.0	1602	821	0.796	0.929	XYLT1_RAT Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
5	Q9EPL0	0.0	962	865	0.457	0.506	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
6	Q9H1B5	0.0	956	865	0.466	0.517	XYLT2_HUMAN Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2
7	Q7KVA1	5.69e-164	504	876	0.277	0.304	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
8	Q965Q8	1.69e-74	263	806	0.129	0.154	XYLT_CAEEL Xylosyltransferase sqv-6 OS=Caenorhabditis elegans OX=6239 GN=sqv-6 PE=1 SV=3
9	Q9LR71	3.81e-20	97.1	447	0.087	0.186	Q9LR71_ARATH Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g03520 PE=1 SV=1
10	Q9LFQ0	1.20e-19	95.1	434	0.090	0.198	GT14B_ARATH Beta-glucuronosyltransferase GlcAT14B OS=Arabidopsis thaliana OX=3702 GN=GLCAT14B PE=2 SV=1
11	Q9SS69	1.35e-19	94.4	378	0.082	0.209	Q9SS69_ARATH Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=UNE7 PE=1 SV=1
12	Q9FLD7	1.77e-19	94.7	447	0.077	0.166	GT14A_ARATH Beta-glucuronosyltransferase GlcAT14A OS=Arabidopsis thaliana OX=3702 GN=GLCAT14A PE=2 SV=1
13	F4JIW2	3.79e-18	90.5	421	0.073	0.166	F4JIW2_ARATH Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g27480 PE=1 SV=1
14	Q9C9A1	9.39e-18	89.0	395	0.073	0.177	Q9C9A1_ARATH At1g71070/F23N20_6 OS=Arabidopsis thaliana OX=3702 GN=At1g71070 PE=1 SV=1
15	Q8S8P3	1.13e-16	85.5	384	0.083	0.208	GT14C_ARATH Beta-glucuronosyltransferase GlcAT14C OS=Arabidopsis thaliana OX=3702 GN=GLCAT14C PE=2 SV=1
16	Q9LE60	1.68e-15	82.4	424	0.082	0.186	Q9LE60_ARATH AT3g15350/K7L4_15 OS=Arabidopsis thaliana OX=3702 GN=At3g15350 PE=1 SV=1
17	Q9LIQ3	3.05e-12	72.0	417	0.065	0.149	Q9LIQ3_ARATH Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24040 PE=1 SV=1
18	Q6T5E0	5.56e-12	71.2	400	0.073	0.175	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
19	Q02742	1.17e-11	70.5	428	0.059	0.133	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
20	Q9P109	3.22e-11	68.9	453	0.068	0.143	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02485 Branch	4.7e-47	172.1	Core-2/I-Branching enzyme
2	PF12529 Xylo_C	3.6e-67	237.1	Xylosyltransferase C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000029410	0.983	Beta-1,4-galactosyltransferase 7
2	9606.ENSP00000370542	0.983	Syndecan-1
3	9606.ENSP00000052754	0.943	Decorin
4	9606.ENSP00000363827	0.938	Basement membrane-specific heparan sulfate proteoglycan core protein
5	9606.ENSP00000327336	0.935	Biglycan
6	9606.ENSP00000252575	0.933	Neurocan core protein
7	9606.ENSP00000265077	0.930	Versican core protein
8	9606.ENSP00000331210	0.930	Brevican core protein
9	9606.ENSP00000307046	0.928	Syndecan-2
10	9606.ENSP00000292377	0.925	Glypican-2
11	9606.ENSP00000366267	0.922	Glypican-5
12	9606.ENSP00000361818	0.921	Syndecan-4
13	9606.ENSP00000359864	0.920	Glypican-4
14	9606.ENSP00000264039	0.918	Glypican-1
15	9606.ENSP00000344468	0.918	Syndecan-3
16	9606.ENSP00000366246	0.916	Glypican-6
17	9606.ENSP00000377836	0.916	Glypican-3
18	9606.ENSP00000368678	0.914	Agrin
19	9606.ENSP00000382274	0.908	Nodal modulator 3
20	9606.ENSP00000312506	0.905	Chondroitin sulfate proteoglycan 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030158	1.000	protein xylosyltransferase activity
GO:0005488	0.689	binding
GO:0016758	0.566	hexosyltransferase activity
GO:0005515	0.308	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:1901564	0.978	organonitrogen compound metabolic process
GO:1901576	0.965	organic substance biosynthetic process
GO:0044249	0.965	cellular biosynthetic process
GO:0019538	0.964	protein metabolic process
GO:0006022	0.955	aminoglycan metabolic process
GO:0030203	0.945	glycosaminoglycan metabolic process
GO:0044272	0.939	sulfur compound biosynthetic process
GO:0030166	0.929	proteoglycan biosynthetic process
GO:0006024	0.914	glycosaminoglycan biosynthetic process
GO:0050654	0.844	chondroitin sulfate proteoglycan metabolic process
GO:0050650	0.539	chondroitin sulfate proteoglycan biosynthetic process
GO:0015012	0.395	heparan sulfate proteoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.987	membrane
GO:0005576	0.953	extracellular region
GO:0031090	0.896	organelle membrane
GO:0005615	0.817	extracellular space
GO:0098588	0.797	bounding membrane of organelle
GO:0000139	0.790	Golgi membrane
GO:0070013	0.587	intracellular organelle lumen
GO:0031984	0.405	organelle subcompartment
GO:0098791	0.300	Golgi apparatus subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:50192	1.000	L-seryl-[protein] + UDP-alpha-D-xylose = 3-O-(beta-D-xylosyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.2.26	1.000	protein xylosyltransferase.
EC:2.4.1.-	0.566	Hexosyltransferases.

[back to server]