StarFunc result for job id Q86Y78

User Input

>input (171 residues)
MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYE
CNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTS
CCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZTT2	0.826	0.826	1.216E-33	171	0.942	0.942	D3ZTT2.pdb.gz	LYPD6_RAT Ly6/PLAUR domain-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Lypd6 PE=1 SV=2
2	AFDB:Q66IA6	0.736	0.725	1.108E-26	174	0.678	0.667	Q66IA6.pdb.gz	LYPD6_DANRE Ly6/PLAUR domain-containing protein 6 OS=Danio rerio OX=7955 GN=lypd6 PE=1 SV=1
3	AFDB:Q8NI32	0.610	0.572	3.407E-18	183	0.386	0.361	Q8NI32.pdb.gz	LPD6B_HUMAN Ly6/PLAUR domain-containing protein 6B OS=Homo sapiens OX=9606 GN=LYPD6B PE=1 SV=1
4	AFDB:Q64253	0.386	0.474	4.757E-6	136	0.181	0.228	Q64253.pdb.gz	LY6E_MOUSE Lymphocyte antigen 6E OS=Mus musculus OX=10090 GN=Ly6e PE=1 SV=3
5	AFDB:A0A1D5P7D9	0.388	0.513	5.066E-6	126	0.181	0.246	A0A1D5P7D9.pdb.gz
6	AFDB:Q5SRR4	0.389	0.434	9.496E-6	150	0.146	0.167	Q5SRR4.pdb.gz	LY65C_HUMAN Lymphocyte antigen 6 complex locus protein G5c OS=Homo sapiens OX=9606 GN=LY6G5C PE=1 SV=1
7	AFDB:P35459	0.363	0.475	1.147E-5	127	0.170	0.228	P35459.pdb.gz	LY6D_MOUSE Lymphocyte antigen 6D OS=Mus musculus OX=10090 GN=Ly6d PE=1 SV=1
8	AFDB:Q9VPR7	0.406	0.450	1.221E-5	153	0.205	0.229	Q9VPR7.pdb.gz	Q9VPR7_DROME Coiled, isoform A OS=Drosophila melanogaster OX=7227 GN=cold PE=2 SV=1
9	AFDB:Q14210	0.375	0.488	1.570E-5	128	0.181	0.242	Q14210.pdb.gz	LY6D_HUMAN Lymphocyte antigen 6D OS=Homo sapiens OX=9606 GN=LY6D PE=1 SV=1
10	AFDB:P57096	0.367	0.496	1.896E-5	123	0.187	0.260	P57096.pdb.gz	PSCA_MOUSE Prostate stem cell antigen OS=Mus musculus OX=10090 GN=Psca PE=1 SV=2
11	PDB:2n99A	0.298	0.612	3.177E-3	76	0.123	0.276	2n99A.pdb.gz
12	PDB:3laqV	0.346	0.237	1.529E-2	260	0.105	0.069	3laqV.pdb.gz
13	PDB:6zzeA	0.321	0.583	1.628E-2	82	0.146	0.305	6zzeA.pdb.gz
14	PDB:6wjcC	0.279	0.602	1.733E-2	69	0.088	0.217	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
15	PDB:3vtsA	0.233	0.566	6.091E-2	61	0.088	0.246	3vtsA.pdb.gz
16	PDB:3bt1U	0.319	0.212	7.832E-2	273	0.082	0.051	3bt1U.pdb.gz
17	PDB:6rc7A	0.216	0.500	1.072E-1	60	0.094	0.267	6rc7A.pdb.gz
18	PDB:4zqyA	0.240	0.566	2.010E-1	65	0.088	0.231	4zqyA.pdb.gz
19	PDB:5ms3A	0.130	0.108	8.531E-1	228	0.099	0.075	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
20	PDB:4v96AA	0.130	0.081	9.673E-1	299	0.070	0.040	4v96AA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86Y78	1.89e-127	356	171	1.000	1.000	LYPD6_HUMAN Ly6/PLAUR domain-containing protein 6 OS=Homo sapiens OX=9606 GN=LYPD6 PE=1 SV=1
2	Q8BPP5	2.95e-112	318	171	0.947	0.947	LYPD6_MOUSE Ly6/PLAUR domain-containing protein 6 OS=Mus musculus OX=10090 GN=Lypd6 PE=1 SV=1
3	D3ZTT2	9.04e-112	317	171	0.942	0.942	LYPD6_RAT Ly6/PLAUR domain-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Lypd6 PE=1 SV=2
4	Q66IA6	4.30e-84	247	174	0.649	0.638	LYPD6_DANRE Ly6/PLAUR domain-containing protein 6 OS=Danio rerio OX=7955 GN=lypd6 PE=1 SV=1
5	Q8NI32	1.71e-34	121	183	0.322	0.301	LPD6B_HUMAN Ly6/PLAUR domain-containing protein 6B OS=Homo sapiens OX=9606 GN=LYPD6B PE=1 SV=1
6	P35456	0.023	37.0	327	0.146	0.076	UPAR_MOUSE Urokinase plasminogen activator surface receptor OS=Mus musculus OX=10090 GN=Plaur PE=1 SV=1
7	P0DP60	0.22	32.7	116	0.158	0.233	LYNX1_MOUSE Ly-6/neurotoxin-like protein 1 OS=Mus musculus OX=10090 GN=Lynx1 PE=1 SV=1
8	P15205	0.37	33.5	2461	0.187	0.013	MAP1B_RAT Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3
9	P49616	0.74	32.3	328	0.135	0.070	UPAR_RAT Urokinase plasminogen activator surface receptor OS=Rattus norvegicus OX=10116 GN=Plaur PE=2 SV=2
10	P14873	0.87	32.3	2464	0.193	0.013	MAP1B_MOUSE Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2
11	Q8N2G4	1.1	31.2	141	0.152	0.184	LYPD1_HUMAN Ly6/PLAUR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LYPD1 PE=1 SV=2
12	Q8N6Q3	1.2	31.6	437	0.094	0.037	CD177_HUMAN CD177 antigen OS=Homo sapiens OX=9606 GN=CD177 PE=1 SV=2
13	Q8BLC3	1.3	30.8	141	0.152	0.184	LYPD1_MOUSE Ly6/PLAUR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lypd1 PE=1 SV=1
14	Q9SKP0	2.0	31.2	448	0.076	0.029	ECP63_ARATH Late embryogenesis abundant protein ECP63 OS=Arabidopsis thaliana OX=3702 GN=ECP63 PE=2 SV=1
15	P05533	2.2	30.0	134	0.158	0.201	LY6A_MOUSE Lymphocyte antigen 6A-2/6E-1 OS=Mus musculus OX=10090 GN=Ly6a PE=1 SV=1
16	Q9GUJ2	3.2	30.4	352	0.164	0.080	Q9GUJ2_CAEEL Activin_recp domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y45G5AM.6 PE=4 SV=2
17	Q15JG7	5.1	29.6	365	0.082	0.038	VLDW_STRHL Validamycin A dioxygenase OS=Streptomyces hygroscopicus subsp. limoneus OX=264445 GN=vldW PE=1 SV=1
18	P0DP58	7.6	28.5	116	0.152	0.224	LYNX1_HUMAN Ly-6/neurotoxin-like protein 1 OS=Homo sapiens OX=9606 GN=LYNX1 PE=1 SV=1
19	Q7ZUU9	7.9	29.3	512	0.076	0.025	Q7ZUU9_DANRE Retinoblastoma-binding protein 5 OS=Danio rerio OX=7955 GN=zgc:56078 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	0.74	22.1	Activin types I and II receptor domain
2	PF16975 UPAR_LY6_2	1.1e-52	188.1	Ly6/PLAUR domain-containing protein 6, Lypd6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000012219

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005387	0.693	Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
2	60711.ENSCSAP00000005477	0.693	Secreted LY6/PLAUR domain containing 1
3	60711.ENSCSAP00000005394	0.682	Lymphocyte antigen 6 complex, locus H
4	60711.ENSCSAP00000008764	0.640	Leucine rich repeat containing 34
5	60711.ENSCSAP00000003674	0.628	Transient receptor potential cation channel, subfamily V, member 6
6	60711.ENSCSAP00000011619	0.578	Transmembrane protein 174
7	60711.ENSCSAP00000005487	0.575	Lymphocyte antigen 6 complex, locus K
8	60711.ENSCSAP00000006319	0.570	Family with sequence similarity 196, member B
9	60711.ENSCSAP00000005511	0.565	Prostate stem cell antigen
10	60711.ENSCSAP00000010433	0.558	Uncharacterized protein
11	60711.ENSCSAP00000012516	0.553	LY6/PLAUR domain containing 1
12	60711.ENSCSAP00000007376	0.552	Cytochrome P450, family 19, subfamily A, polypeptide 1
13	60711.ENSCSAP00000014544	0.515	TBC1 domain family, member 9 (with GRAM domain)
14	60711.ENSCSAP00000005238	0.512	Low density lipoprotein receptor-related protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030550	0.999	acetylcholine receptor inhibitor activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009966	0.958	regulation of signal transduction
GO:0048518	0.857	positive regulation of biological process
GO:0032502	0.856	developmental process
GO:0048522	0.844	positive regulation of cellular process
GO:0009987	0.727	cellular process
GO:0051239	0.699	regulation of multicellular organismal process
GO:0048856	0.651	anatomical structure development
GO:0023056	0.517	positive regulation of signaling
GO:0010647	0.517	positive regulation of cell communication
GO:0048584	0.494	positive regulation of response to stimulus
GO:0009967	0.475	positive regulation of signal transduction
GO:0050896	0.451	response to stimulus
GO:0050793	0.442	regulation of developmental process
GO:0048519	0.397	negative regulation of biological process
GO:0031128	0.390	developmental induction
GO:2000026	0.377	regulation of multicellular organismal development
GO:0009653	0.345	anatomical structure morphogenesis
GO:0048523	0.323	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.979	plasma membrane
GO:0042995	0.722	cell projection
GO:0005576	0.470	extracellular region
GO:0120025	0.310	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]