StarFunc result for job id Q86Y97

User Input

>input (462 residues)
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y97	1.000	1.000	1.558E-86	462	1.000	1.000	Q86Y97.pdb.gz	KMT5C_HUMAN Histone-lysine N-methyltransferase KMT5C OS=Homo sapiens OX=9606 GN=KMT5C PE=1 SV=1
2	AFDB:Q6Q783	0.541	0.534	1.354E-66	468	0.818	0.808	Q6Q783.pdb.gz	KMT5C_MOUSE Histone-lysine N-methyltransferase KMT5C OS=Mus musculus OX=10090 GN=Kmt5c PE=1 SV=1
3	AFDB:Q5U3H2	0.518	0.299	3.745E-39	808	0.439	0.251	Q5U3H2.pdb.gz	KMT5B_DANRE Histone-lysine N-methyltransferase KMT5B OS=Danio rerio OX=7955 GN=kmt5b PE=2 SV=2
4	AFDB:F1Q9U2	0.523	0.119	9.095E-39	2065	0.411	0.092	F1Q9U2.pdb.gz
5	AFDB:Q9W5E0	0.496	0.179	4.089E-33	1300	0.364	0.129	Q9W5E0.pdb.gz	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
6	PDB:2g46A	0.196	0.671	3.038E-6	119	0.045	0.176	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
7	PDB:5h6zA	0.206	0.688	4.876E-6	123	0.050	0.187	5h6zA.pdb.gz
8	PDB:5hynA	0.191	0.155	7.866E-5	581	0.048	0.038	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
9	PDB:5wg6A	0.190	0.172	7.866E-5	517	0.056	0.050	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
10	PDB:7td5F	0.193	0.199	1.801E-4	447	0.043	0.045	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
11	PDB:7td5A	0.199	0.186	3.254E-4	497	0.048	0.044	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
12	PDB:7ksoA	0.187	0.215	5.224E-4	395	0.045	0.053	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
13	PDB:1pegA	0.195	0.324	7.022E-4	266	0.050	0.086	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
14	PDB:6wkrC	0.189	0.147	7.022E-4	606	0.050	0.038	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
15	PDB:5v3hA	0.152	0.159	8.897E-4	438	0.056	0.059	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
16	AFDB:E9PZZ1	0.088	0.058	7.182E-2	754	0.147	0.090	E9PZZ1.pdb.gz	PRD13_MOUSE PR domain zinc finger protein 13 OS=Mus musculus OX=10090 GN=Prdm13 PE=2 SV=1
17	AFDB:Q6FPN0	0.047	0.028	1.468	870	0.084	0.045	Q6FPN0.pdb.gz	AWP1_CANGA Adhesin AWP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP1 PE=1 SV=1
18	AFDB:Q8IBB0	0.216	0.047	1.468	2399	0.058	0.011	Q8IBB0.pdb.gz	Q8IBB0_PLAF7 SET domain protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0827800 PE=4 SV=1
19	AFDB:Q15428	0.110	0.109	2.093	464	0.145	0.144	Q15428.pdb.gz	SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2
20	AFDB:F1M9C5	0.070	0.064	2.652	529	0.123	0.108	F1M9C5.pdb.gz	F1M9C5_RAT RUNX family transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Runx2 PE=4 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SF94	0.0	704	347	0.751	1.000	A0A0D9SF94_HUMAN [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5C PE=1 SV=1
2	Q6Q783	0.0	694	468	0.803	0.793	KMT5C_MOUSE Histone-lysine N-methyltransferase KMT5C OS=Mus musculus OX=10090 GN=Kmt5c PE=1 SV=1
3	Q86Y97	0.0	936	462	1.000	1.000	KMT5C_HUMAN Histone-lysine N-methyltransferase KMT5C OS=Homo sapiens OX=9606 GN=KMT5C PE=1 SV=1
4	Q4FZB7	8.63e-112	352	885	0.364	0.190	KMT5B_HUMAN Histone-lysine N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5B PE=1 SV=5
5	Q5U3H2	1.28e-111	349	808	0.351	0.200	KMT5B_DANRE Histone-lysine N-methyltransferase KMT5B OS=Danio rerio OX=7955 GN=kmt5b PE=2 SV=2
6	A5D6U3	1.41e-111	340	522	0.359	0.318	A5D6U3_DANRE [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B OS=Danio rerio OX=7955 GN=suv420h2 PE=2 SV=1
7	Q3U8K7	7.71e-111	349	883	0.364	0.190	KMT5B_MOUSE Histone-lysine N-methyltransferase KMT5B OS=Mus musculus OX=10090 GN=Kmt5b PE=1 SV=2
8	Q9W5E0	3.86e-78	266	1300	0.299	0.106	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
9	Q09265	2.91e-64	211	288	0.255	0.410	SUV42_CAEEL Histone-lysine N-methyltransferase Suv4-20 OS=Caenorhabditis elegans OX=6239 GN=set-4 PE=1 SV=1
10	Q9USK2	6.77e-24	105	441	0.123	0.129	SET9_SCHPO Histone-lysine N-methyltransferase set9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set9 PE=1 SV=1
11	B8JIA4	7.76e-04	44.7	1461	0.078	0.025	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
12	Q389M6	0.006	41.6	999	0.045	0.021	Q389M6_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0910 PE=4 SV=1
13	Q8R5A0	0.007	41.2	433	0.061	0.065	SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus OX=10090 GN=Smyd2 PE=1 SV=1
14	Q7M6Z3	0.010	40.4	433	0.061	0.065	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
15	Q9NRG4	0.011	40.4	433	0.082	0.088	SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2
16	O96028	0.013	40.4	1365	0.076	0.026	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
17	Q582H7	0.017	40.0	429	0.035	0.037	Q582H7_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.380 PE=4 SV=1
18	Q57YP8	0.021	39.7	545	0.048	0.040	Q57YP8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.10 PE=4 SV=1
19	Q8BVE8	0.024	39.7	1365	0.076	0.026	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
20	Q9H7B4	0.033	38.9	428	0.052	0.056	SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	4e-07	42.1	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384629	0.836	N-lysine methyltransferase KMT5A
2	9606.ENSP00000367755	0.769	Calmodulin-lysine N-methyltransferase
3	9606.ENSP00000244537	0.766	Histone cluster 1 H4 family member f
4	9606.ENSP00000346997	0.754	Histone-lysine N-methyltransferase SUV39H2
5	9606.ENSP00000484789	0.749	Histone H4
6	9606.ENSP00000337976	0.739	Histone-lysine N-methyltransferase SUV39H1
7	9606.ENSP00000310649	0.720	Serine/threonine-protein kinase BRSK1
8	9606.ENSP00000386759	0.719	Histone-lysine N-methyltransferase SETD2
9	9606.ENSP00000271640	0.704	Histone-lysine N-methyltransferase SETDB1
10	9606.ENSP00000362456	0.698	Protein PBDC1
11	9606.ENSP00000336687	0.696	Chromobox protein homolog 3
12	9606.ENSP00000347168	0.693	Histone cluster 1 H4 family member j
13	9606.ENSP00000366956	0.693	Histone cluster 1 H4 family member h
14	9606.ENSP00000366974	0.693	Histone cluster 1 H4 family member b
15	9606.ENSP00000367034	0.693	Histone cluster 1 H4 family member c
16	9606.ENSP00000443017	0.693	Histone cluster 4, H4
17	9606.ENSP00000462355	0.693	Histone cluster 2 H4 family member b
18	9606.ENSP00000462667	0.693	Histone cluster 2 H4 family member a
19	9606.ENSP00000479106	0.693	Histone cluster 1 H4 family member a
20	9606.ENSP00000479461	0.693	Histone cluster 1 H4 family member d

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:0042799	0.997	histone H4K20 methyltransferase activity
GO:1901681	0.996	sulfur compound binding
GO:0043169	0.993	cation binding
GO:0003682	0.988	chromatin binding
GO:1904047	0.962	S-adenosyl-L-methionine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0043170	0.990	macromolecule metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0044260	0.979	cellular macromolecule metabolic process
GO:0051052	0.978	regulation of DNA metabolic process
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0048583	0.972	regulation of response to stimulus
GO:0051716	0.965	cellular response to stimulus
GO:0006725	0.958	cellular aromatic compound metabolic process
GO:0006974	0.957	cellular response to DNA damage stimulus
GO:0051054	0.927	positive regulation of DNA metabolic process
GO:0046483	0.926	heterocycle metabolic process
GO:1901360	0.925	organic cyclic compound metabolic process
GO:0034641	0.925	cellular nitrogen compound metabolic process
GO:0090304	0.920	nucleic acid metabolic process
GO:2001020	0.912	regulation of response to DNA damage stimulus
GO:0006259	0.858	DNA metabolic process
GO:0048584	0.828	positive regulation of response to stimulus
GO:0006282	0.632	regulation of DNA repair
GO:0010468	0.582	regulation of gene expression
GO:0006281	0.442	DNA repair
GO:2000779	0.355	regulation of double-strand break repair
GO:0043412	0.347	macromolecule modification
GO:2001022	0.347	positive regulation of response to DNA damage stimulus
GO:0045739	0.344	positive regulation of DNA repair
GO:1901564	0.300	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005654	0.999	nucleoplasm
GO:0098687	0.991	chromosomal region
GO:0000785	0.944	chromatin
GO:0000775	0.929	chromosome, centromeric region
GO:0000792	0.668	heterochromatin
GO:0005721	0.318	pericentric heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]