StarFunc result for job id Q86YA3

User Input

>input (2104 residues)
MESQEFIVLYTHQKMKKSKVWQDGILKITHLGNKAILYDDKGACLESLFLKCLEVKPGDD
LESDRYLITVEEVKVAGAIGIVKQNVNKEAPELNSRTFISSGRSLGCQPSGLKRKFTGFQ
GPRQVPKKMVIMESGESAASHEAKKTGPTIFSPFCSMPPLFPTVGKKDVNNILADPENIV
TYKNRERNAMDFSSVFSPSFQINPEVLCEENYFCSPVNSGNKLSDSLLTNEPVKRDSLAS
HYSGVSQNIRSKAQILALLKSESSSSCEELNSEMTEHFPQKQPQGSLKIATKPKYLIQQE
ECAEMKSTENLYYQHQSENTMRNKSRWAMYLSSQSSPIHSSTVDGNDTERKPKAQEDDVN
SNLKDLSLQKIIQFVETYAEERKKYNVDQSVGNNDPSWNQEVKLEIPSFNESSSLQVTCS
SAENDGILSESDIQEDNKIPFNQNDKGCIKGSVLIKENAQEVNTCGTLEKEYEQSESSLP
ELKHLQIESSNNSRISDDITDMISESKMDNESLNSIHESLSNVTQPFLEVTFNLNNFETS
DTEEESQESNKISQDSESWVKDILVNDGNSCFQKRSENTNCEEIEGEHLPFLTSVSDKPT
VTFPVKETLPSQFCDKTYVGFDMGICKTENTGKEIEEYSDTLSNFESFKWTDAVYGDNKE
DANKPIQEVRINYDFALPPNKSKGINMNLHIPHIQNQIAENSNLFSEDAQPQPFILGSDL
DKNDEHVLPSTSSSDNSVQLLNTNQNHYECIALDKSNTHISNSLFYPLGKKHLISKDTEA
HISEPEDLGKIRSPPPDHVEVETAREGKQYWNPRNSSELSGLVNTISILKSLCEHSTALD
SLEILKKKNTVFQQGTQQTYEPDSPPEVRKPFITVVSPKSPHLHKDSQQILKEDEVELSE
PLQSVQFSSSGSKEETAFQAVIPKQIERKTCDPKPVEFQGHQVKGSATSGVMVRGHSSQL
GCSQFPDSTEYENFMTETPELPSTCMQIDFLQVTSPEENISTLSPVSTFSLNSRDEDFMV
EFSETSLKARTLPDDLHFLNLEGMKKSRSLENENLQRLSLLSRTQVPLITLPRTDGPPDL
DSHSYMINSNTYESSGSPMLNLCEKSAVLSFSIEPEDQNETFFSEESREVNPGDVSLNNI
STQSKWLKYQNTSQCNVATPNRVDKRITDGFFAEAVSGMHFRDTSERQSDAVNESSLDSV
HLQMIKGMLYQQRQDFSSQDSVSRKKVLSLNLKQTSKTEEIKNVLGGSTCYNYSVKDLQE
ISGSELCFPSGQKIKSAYLPQRQIHIPAVFQSPAHYKQTFTSCLIEHLNILLFGLAQNLQ
KALSKVDISFYTSLKGEKLKNAENNVPSCHHSQPAKLVMVKKEGPNKGRLFYTCDGPKAD
RCKFFKWLEDVTPGYSTQEGARPGMVLSDIKSIGLYLRSQKIPLYEECQLLVRKGFDFQR
KQYGKLKKFTTVNPEFYNEPKTKLYLKLSRKERSSAYSKNDLWVVSKTLDFELDTFIACS
AFFGPSSINEIEILPLKGYFPSNWPTNMVVHALLVCNASTELTTLKNIQDYFNPATLPLT
QYLLTTSSPTIVSNKRVSKRKFIPPAFTNVSTKFELLSLGATLKLASELIQVHKLNKDQA
TALIQIAQMMASHESIEEVKELQTHTFPITIIHGVFGAGKSYLLAVVILFFVQLFEKSEA
PTIGNARPWKLLISSSTNVAVDRVLLGLLSLGFENFIRVGSVRKIAKPILPYSLHAGSEN
ESEQLKELHALMKEDLTPTERVYVRKSIEQHKLGTNRTLLKQVRVVGVTCAACPFPCMND
LKFPVVVLDECSQITEPASLLPIARFECEKLILVGDPKQLPPTIQGSDAAHENGLEQTLF
DRLCLMGHKPILLRTQYRCHPAISAIANDLFYKGALMNGVTEIERSPLLEWLPTLCFYNV
KGLEQIERDNSFHNVAEATFTLKLIQSLIASGIAGSMIGVITLYKSQMYKLCHLLSAVDF
HHPDIKTVQVSTVDAFQGAEKEIIILSCVRTRQVGFIDSEKRMNVALTRGKRHLLIVGNL
ACLRKNQLWGRVIQHCEGREDGLQHANQYEPQLNHLLKDYFEKQVEEKQKKKSEKEKSKD
KSHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5eanA	0.203	0.388	5.532E-33	1051	0.068	0.136	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
2	PDB:4pj3A	0.238	0.362	4.669E-26	1335	0.061	0.097	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
3	PDB:3jb9X	0.205	0.343	5.031E-14	1195	0.051	0.090	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
4	PDB:5ld2D	0.129	0.398	3.048E-10	605	0.033	0.116	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
5	PDB:3k70D	0.114	0.370	2.689E-9	547	0.032	0.122	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
6	PDB:2is4B	0.125	0.376	1.453E-8	632	0.038	0.125	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
7	PDB:2is6A	0.120	0.349	7.045E-8	654	0.038	0.122	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
8	PDB:7zelA	0.107	0.244	5.886E-7	827	0.024	0.062	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
9	PDB:1w36B	0.093	0.158	7.318E-7	1158	0.038	0.070	1w36B.pdb.gz	Crystal Structure of Recbcd Enzyme Reveals a Machine for Processing DNA Breaks
10	PDB:1uaaA	0.117	0.354	1.014E-6	636	0.038	0.126	1uaaA.pdb.gz	Major domain swiveling revealed by the crystal structures of complexes of E. coli Rep helicase bound to single-stranded DNA and ADP.
11	AFDB:P42694	0.194	0.209	7.309E-6	1942	0.071	0.077	P42694.pdb.gz	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
12	AFDB:Q6DFV5	0.188	0.200	4.172E-5	1964	0.071	0.076	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
13	AFDB:O74939	0.035	0.101	8.939E-5	715	0.058	0.171	O74939.pdb.gz	YJB1_SCHPO Uncharacterized protein C553.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC553.01c PE=4 SV=3
14	AFDB:F6T0B3	0.047	0.045	1.957E-2	1650	0.094	0.119	F6T0B3.pdb.gz	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
15	AFDB:Q61687	0.125	0.110	3.025E-2	2476	0.119	0.101	Q61687.pdb.gz	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
16	AFDB:O15069	0.033	0.039	6.843E-2	1562	0.104	0.140	O15069.pdb.gz	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
17	AFDB:Q9P266	0.035	0.040	8.057E-2	1359	0.101	0.157	Q9P266.pdb.gz	JCAD_HUMAN Junctional cadherin 5-associated protein OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3
18	AFDB:P46100	0.080	0.070	9.487E-2	2492	0.114	0.096	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
19	AFDB:O57539	0.023	0.031	2.146E-1	1391	0.073	0.111	O57539.pdb.gz	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
20	AFDB:Q9H792	0.038	0.042	2.527E-1	1746	0.112	0.135	Q9H792.pdb.gz	PEAK1_HUMAN Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EPU0	2.35e-51	202	1124	0.066	0.124	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
2	A0A024R7L5	3.19e-51	201	1118	0.066	0.124	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
3	Q92900	3.29e-51	201	1129	0.066	0.123	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
4	Q9FJR0	3.69e-51	201	1254	0.066	0.111	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
5	F1RCY6	5.42e-51	200	1100	0.066	0.126	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
6	O76512	1.88e-50	198	1069	0.067	0.133	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
7	Q582F1	9.80e-50	194	842	0.069	0.172	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
8	P30771	1.31e-48	192	971	0.069	0.150	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
9	Q09820	8.41e-48	189	925	0.063	0.144	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
10	Q9VYS3	1.60e-47	189	1180	0.065	0.115	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
11	B6SFA4	1.81e-43	174	818	0.060	0.154	MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana OX=3702 GN=MAA3 PE=2 SV=1
12	O94387	2.44e-37	157	1944	0.050	0.055	YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.10c PE=3 SV=1
13	Q92355	4.19e-37	156	1687	0.048	0.060	SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sen1 PE=1 SV=1
14	O64476	4.35e-37	155	1090	0.048	0.094	O64476_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g19120 PE=1 SV=1
15	Q00416	3.62e-34	147	2231	0.047	0.044	SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEN1 PE=1 SV=2
16	A2AKX3	4.02e-34	147	2646	0.082	0.065	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
17	Q9SZW3	5.97e-34	145	1311	0.045	0.072	Q9SZW3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g30100 PE=1 SV=1
18	Q7Z333	1.92e-33	144	2677	0.074	0.058	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4
19	F4I5Z7	4.42e-33	143	2114	0.050	0.050	F4I5Z7_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g16800 PE=1 SV=2
20	F4K1G7	6.26e-33	142	961	0.067	0.147	F4K1G7_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MEE13.8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	2.2e-19	81.8	AAA domain
2	PF13087 AAA_12	5.4e-47	171.5	AAA domain
3	PF13245 AAA_19	1.5e+02	14.0	AAA domain
4	PF13604 AAA_30	6.1	18.0	AAA domain
5	PF10382 DUF2439	2.1e-16	71.3	Protein of unknown function (DUF2439)
6	PF01443 Viral_helicase1	0.0017	29.7	Viral (Superfamily 1) RNA helicase
7	PF06839 zf-GRF	5.2e-10	50.6	GRF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424737

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454836	0.696	Transducin beta-like protein 3
2	9606.ENSP00000420176	0.685	DNA polymerase epsilon subunit 4
3	9606.ENSP00000264596	0.666	Endonuclease 8-like 3
4	9606.ENSP00000359160	0.653	tRNA:m(4)X modification enzyme TRM13 homolog
5	9606.ENSP00000364126	0.650	DNA-(apurinic or apyrimidinic site) lyase 2
6	9606.ENSP00000264951	0.649	5'-3' exoribonuclease 1
7	9606.ENSP00000366135	0.644	Exosome component 10
8	9606.ENSP00000418721	0.643	Purine-rich element-binding protein gamma
9	9606.ENSP00000348708	0.621	Regulator of nonsense transcripts 2
10	9606.ENSP00000373715	0.619	m7GpppN-mRNA hydrolase
11	9606.ENSP00000247003	0.618	Probable ATP-dependent RNA helicase DDX49
12	9606.ENSP00000333934	0.595	tRNA (guanine(10)-N2)-methyltransferase homolog
13	9606.ENSP00000353741	0.586	Eukaryotic peptide chain release factor subunit 1
14	9606.ENSP00000381298	0.586	LON peptidase N-terminal domain and ring finger 1
15	9606.ENSP00000399938	0.582	FLYWCH-type zinc finger 1
16	9606.ENSP00000366396	0.578	5'-3' exoribonuclease 2
17	9606.ENSP00000356520	0.575	ATP-dependent RNA helicase A
18	9606.ENSP00000381133	0.564	Fibrinogen-like protein 1
19	9606.ENSP00000238146	0.563	ATP-dependent RNA helicase DDX55
20	9606.ENSP00000269349	0.561	Eukaryotic initiation factor 4A-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.993	nucleic acid binding
GO:0003824	0.840	catalytic activity
GO:0140640	0.747	catalytic activity, acting on a nucleic acid
GO:0003723	0.631	RNA binding
GO:0140098	0.513	catalytic activity, acting on RNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0050789	0.990	regulation of biological process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0090304	0.983	nucleic acid metabolic process
GO:0019222	0.935	regulation of metabolic process
GO:0050794	0.904	regulation of cellular process
GO:0060255	0.781	regulation of macromolecule metabolic process
GO:0044260	0.669	cellular macromolecule metabolic process
GO:0051171	0.565	regulation of nitrogen compound metabolic process
GO:0080090	0.552	regulation of primary metabolic process
GO:0031323	0.515	regulation of cellular metabolic process
GO:0048518	0.472	positive regulation of biological process
GO:0016070	0.450	RNA metabolic process
GO:0071840	0.409	cellular component organization or biogenesis
GO:0048519	0.391	negative regulation of biological process
GO:0050896	0.374	response to stimulus
GO:0010468	0.368	regulation of gene expression
GO:0048522	0.340	positive regulation of cellular process
GO:0019219	0.321	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0005829	0.936	cytosol
GO:0032991	0.876	protein-containing complex
GO:0005694	0.422	chromosome
GO:0012505	0.300	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]