StarFunc result for job id Q86YB7

User Input

>input (292 residues)
MLRVLCLLRPWRPLRARGCASDGAAGGSEIQVRALAGPDQGITEILMNRPSARNALGNVF
VSELLETLAQLREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEAEVGVFVQRLRGLMND
IAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRC
LGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIAVR
LGKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAAFREKRTPKFVGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1Z934	0.905	0.884	1.886E-39	299	0.545	0.532	A1Z934.pdb.gz	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
2	AFDB:Q9JLZ3	0.902	0.839	8.762E-39	314	0.527	0.490	Q9JLZ3.pdb.gz	AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Auh PE=1 SV=1
3	AFDB:Q13825	0.904	0.779	2.392E-38	339	0.517	0.445	Q13825.pdb.gz	AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1
4	AFDB:F4JML5	0.889	0.863	2.544E-36	301	0.442	0.429	F4JML5.pdb.gz	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
5	AFDB:A4YI89	0.848	0.953	9.432E-28	259	0.360	0.405	A4YI89.pdb.gz	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	PDB:5zaiC	0.841	0.944	4.584E-27	259	0.360	0.405	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
7	AFDB:P9WNN9	0.818	0.925	1.517E-25	257	0.336	0.381	P9WNN9.pdb.gz	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
8	AFDB:C8V3K8	0.827	0.835	2.582E-25	289	0.301	0.304	C8V3K8.pdb.gz	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
9	AFDB:P30084	0.819	0.824	2.906E-25	290	0.329	0.331	P30084.pdb.gz	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
10	AFDB:P76082	0.827	0.942	4.142E-25	255	0.329	0.376	P76082.pdb.gz	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
11	AFDB:P34559	0.824	0.835	4.394E-25	288	0.322	0.326	P34559.pdb.gz	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
12	PDB:4fzwB	0.820	0.930	6.175E-25	256	0.329	0.375	4fzwB.pdb.gz
13	PDB:3h81A	0.810	0.919	1.115E-24	256	0.336	0.383	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
14	PDB:1dubA	0.814	0.909	1.412E-24	260	0.308	0.346	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
15	PDB:2hw5C	0.820	0.916	3.425E-24	260	0.291	0.327	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
16	PDB:4fzwD	0.796	0.924	3.060E-20	250	0.274	0.320	4fzwD.pdb.gz
17	PDB:7oeqA	0.750	0.842	5.860E-20	259	0.264	0.297	7oeqA.pdb.gz
18	PDB:4i42A	0.644	0.658	1.058E-19	285	0.264	0.270	4i42A.pdb.gz	Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme A synthase from the crotonase fold superfamily
19	PDB:6wyiA	0.749	0.916	2.722E-19	237	0.243	0.300	6wyiA.pdb.gz
20	PDB:4izcB	0.803	0.877	2.283E-18	266	0.250	0.274	4izcB.pdb.gz	Crystal Structure of DmdD, a Crotonase Superfamily Enzyme That Catalyzes the Hydration and Hydrolysis of Methylthioacryloyl-CoA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z934	4.58e-101	299	299	0.538	0.525	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
2	Q13825	1.37e-95	287	339	0.521	0.448	AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1
3	Q9JLZ3	3.81e-94	282	314	0.503	0.468	AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Auh PE=1 SV=1
4	F4JML5	8.63e-81	248	301	0.428	0.415	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
5	A4YI89	8.71e-59	190	259	0.363	0.409	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	P9WNN9	1.56e-45	156	257	0.332	0.377	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
7	P76082	2.08e-44	153	255	0.325	0.373	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
8	Q7JR58	3.70e-41	146	295	0.353	0.349	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
9	P34559	3.72e-41	145	288	0.312	0.316	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
10	Q8BH95	6.82e-40	142	290	0.315	0.317	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
11	P30084	8.08e-40	142	290	0.332	0.334	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
12	P14604	9.08e-40	142	290	0.325	0.328	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
13	C8V3K8	5.97e-35	129	289	0.291	0.294	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
14	P31551	6.61e-34	126	261	0.305	0.341	CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=caiD PE=1 SV=4
15	G4V4T7	2.14e-29	114	265	0.284	0.313	DPGD_AMYOR Enoyl-CoA-hydratase OS=Amycolatopsis orientalis OX=31958 GN=dpgD PE=1 SV=1
16	P77399	5.70e-28	115	714	0.264	0.108	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
17	Q64428	7.67e-28	115	763	0.288	0.110	ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadha PE=1 SV=2
18	P9WNN3	8.23e-28	110	261	0.271	0.303	ECH17_MYCTU Probable enoyl-CoA hydratase EchA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA17 PE=1 SV=2
19	Q8BMS1	9.19e-28	114	763	0.284	0.109	ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1
20	Q9FHR8	1.14e-27	110	278	0.274	0.288	DCI1_ARATH Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=DCI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	6e-53	191.3	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	1.6e-29	115.1	Enoyl-CoA hydratase/isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360577

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000474560	0.886	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
2	9606.ENSP00000323811	0.793	2-hydroxyacyl-CoA lyase 1
3	9606.ENSP00000265395	0.768	3-hydroxyisobutyrate dehydrogenase, mitochondrial
4	9606.ENSP00000384610	0.658	Patatin-like phospholipase domain-containing protein 7
5	9606.ENSP00000298248	0.631	Lambda-crystallin homolog
6	9606.ENSP00000318351	0.614	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
7	9606.ENSP00000418397	0.613	Isovaleryl-CoA dehydrogenase, mitochondrial
8	9606.ENSP00000233710	0.606	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
9	9606.ENSP00000438689	0.600	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000343657	0.559	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
11	9606.ENSP00000427567	0.548	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly
12	9606.ENSP00000359871	0.545	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
13	9606.ENSP00000281182	0.512	Isobutyryl-CoA dehydrogenase, mitochondrial
14	9606.ENSP00000357873	0.512	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
15	9606.ENSP00000419027	0.511	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
16	9606.ENSP00000168216	0.508	3-hydroxyacyl-CoA dehydrogenase type-2
17	9606.ENSP00000220764	0.508	2,4-dienoyl-CoA reductase, mitochondrial
18	9606.ENSP00000332287	0.507	Synaptogyrin-1
19	9606.ENSP00000333664	0.507	3-ketoacyl-CoA thiolase, peroxisomal
20	9606.ENSP00000242592	0.505	Short-chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016836	1.000	hydro-lyase activity
GO:0005488	0.988	binding
GO:0004300	0.903	enoyl-CoA hydratase activity
GO:0005515	0.711	protein binding
GO:1901363	0.624	heterocyclic compound binding
GO:0097159	0.624	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0044281	0.897	small molecule metabolic process
GO:0019752	0.667	carboxylic acid metabolic process
GO:1901575	0.655	organic substance catabolic process
GO:0044248	0.648	cellular catabolic process
GO:0046395	0.630	carboxylic acid catabolic process
GO:0006807	0.554	nitrogen compound metabolic process
GO:0032787	0.404	monocarboxylic acid metabolic process
GO:0006629	0.401	lipid metabolic process
GO:1901564	0.374	organonitrogen compound metabolic process
GO:0044255	0.351	cellular lipid metabolic process
GO:0016042	0.347	lipid catabolic process
GO:0050896	0.330	response to stimulus
GO:0006631	0.311	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.988	intracellular organelle lumen
GO:0005759	0.904	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	1.000	Hydro-lyases.
RHEA:16105	0.903	a (3S)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O
EC:4.2.1.17	0.903	enoyl-CoA hydratase.

[back to server]