StarFunc result for job id Q86YD3

User Input

>input (366 residues)
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGT
PRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIVV
AAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPS
NLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVS
SDEIWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD3	1.000	1.000	2.040E-61	366	1.000	1.000	Q86YD3.pdb.gz	TMM25_HUMAN Transmembrane protein 25 OS=Homo sapiens OX=9606 GN=TMEM25 PE=1 SV=1
2	AFDB:P97710	0.361	0.275	7.850E-11	509	0.156	0.112	P97710.pdb.gz	SHPS1_RAT Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Rattus norvegicus OX=10116 GN=Sirpa PE=1 SV=1
3	AFDB:Q15223	0.223	0.167	1.193E-10	517	0.205	0.145	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
4	AFDB:Q92692	0.330	0.238	1.325E-10	538	0.183	0.125	Q92692.pdb.gz	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
5	AFDB:P32507	0.348	0.254	1.472E-10	530	0.191	0.132	P32507.pdb.gz	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
6	AFDB:P97797	0.353	0.267	5.450E-10	513	0.156	0.111	P97797.pdb.gz	SHPS1_MOUSE Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Mus musculus OX=10090 GN=Sirpa PE=1 SV=2
7	AFDB:Q5DX21	0.327	0.285	9.202E-10	431	0.158	0.135	Q5DX21.pdb.gz	IGS11_HUMAN Immunoglobulin superfamily member 11 OS=Homo sapiens OX=9606 GN=IGSF11 PE=1 SV=3
8	AFDB:A0A2R8RYG1	0.338	0.291	1.022E-9	442	0.158	0.131	A0A2R8RYG1.pdb.gz
9	AFDB:Q86XK7	0.346	0.331	1.022E-9	387	0.153	0.145	Q86XK7.pdb.gz	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
10	AFDB:Q9D2Z1	0.282	0.190	1.077E-9	577	0.191	0.121	Q9D2Z1.pdb.gz	CEA20_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 20 OS=Mus musculus OX=10090 GN=Ceacam20 PE=1 SV=1
11	PDB:6dldD	0.322	0.427	1.346E-7	269	0.096	0.130	6dldD.pdb.gz
12	PDB:6dlfA	0.273	0.382	1.578E-6	236	0.090	0.140	6dlfA.pdb.gz
13	PDB:6feyB	0.192	0.316	4.498E-6	207	0.096	0.169	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
14	PDB:1e07A	0.209	0.143	7.207E-6	642	0.082	0.047	1e07A.pdb.gz
15	PDB:3o11A	0.230	0.328	2.533E-5	212	0.096	0.165	3o11A.pdb.gz
16	PDB:1cf8L	0.255	0.369	2.669E-5	215	0.098	0.167	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
17	PDB:4xnyL	0.183	0.277	3.291E-5	211	0.082	0.142	4xnyL.pdb.gz
18	PDB:5oj2B	0.328	0.187	3.655E-5	692	0.107	0.056	5oj2B.pdb.gz
19	PDB:1knoE	0.230	0.337	5.004E-5	214	0.101	0.173	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
20	PDB:1orqA	0.278	0.410	5.273E-5	215	0.101	0.172	1orqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD3	0.0	738	366	1.000	1.000	TMM25_HUMAN Transmembrane protein 25 OS=Homo sapiens OX=9606 GN=TMEM25 PE=1 SV=1
2	Q9DCF1	0.0	646	365	0.910	0.912	TMM25_MOUSE Transmembrane protein 25 OS=Mus musculus OX=10090 GN=Tmem25 PE=1 SV=1
3	Q96RW7	2.43e-04	45.8	5635	0.117	0.008	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
4	A0A0B4LEH1	2.76e-04	45.4	1492	0.164	0.040	A0A0B4LEH1_DROME Sticks and stones, isoform C OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
5	Q0E9F2	2.77e-04	45.4	1542	0.164	0.039	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
6	Q9V4Y0	3.11e-04	45.4	1482	0.164	0.040	Q9V4Y0_DROME SNS OS=Drosophila melanogaster OX=7227 GN=sns PE=2 SV=2
7	A1Z7J1	3.33e-04	45.1	1479	0.164	0.041	A1Z7J1_DROME Sticks and stones, isoform A OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
8	D3YXG0	0.002	42.7	5634	0.104	0.007	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
9	Q9VQW1	0.004	41.6	1198	0.098	0.030	Q9VQW1_DROME Friend of echinoid, isoform G OS=Drosophila melanogaster OX=7227 GN=fred PE=1 SV=4
10	A0A023GPK8	0.005	41.6	1447	0.098	0.025	A0A023GPK8_DROME Friend of echinoid, isoform H OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
11	B8JHX2	0.005	41.2	360	0.107	0.108	B8JHX2_DANRE Intercellular adhesion molecule 3 OS=Danio rerio OX=7955 GN=si:ch211-74m13.3 PE=3 SV=1
12	M9NCR3	0.005	41.6	1323	0.098	0.027	M9NCR3_DROME Friend of echinoid, isoform F OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
13	Q8WZ42	0.006	41.2	34350	0.096	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
14	Q9VR25	0.006	40.8	450	0.115	0.093	Q9VR25_DROME Factor of interpulse interval OS=Drosophila melanogaster OX=7227 GN=fipi PE=1 SV=2
15	E7F3V2	0.019	39.7	4212	0.137	0.012	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
16	Q96J84	0.036	38.5	757	0.107	0.052	KIRR1_HUMAN Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2
17	F6P1M3	0.058	38.1	797	0.104	0.048	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
18	Q96JA1	0.071	37.7	1093	0.148	0.049	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
19	G5EDG4	0.11	37.4	3962	0.123	0.011	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
20	Q6X936	0.11	37.0	789	0.107	0.049	KIRR1_RAT Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	4e-15	67.0	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	0.92	21.0	Immunoglobulin I-set domain
3	PF13927 Ig_3	0.00049	31.9	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315635

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346981	0.722	Transmembrane protein 207
2	9606.ENSP00000326063	0.687	Transmembrane protein 39A
3	9606.ENSP00000373399	0.647	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
4	9606.ENSP00000378328	0.638	Ankyrin repeat domain-containing protein 13B
5	9606.ENSP00000352962	0.630	Lipid phosphate phosphatase-related protein type 3
6	9606.ENSP00000375859	0.629	Interferon induced transmembrane protein domain containing
7	9606.ENSP00000273077	0.614	Probable hydrolase PNKD
8	9606.ENSP00000295569	0.612	Protein FAM19A4
9	9606.ENSP00000450842	0.565	Cell cycle control protein 50B
10	9606.ENSP00000386653	0.553	Protocadherin 20
11	9606.ENSP00000387250	0.553	Protocadherin-20
12	9606.ENSP00000303325	0.525	Neuromedin-K receptor
13	9606.ENSP00000303522	0.525	Substance-P receptor
14	9606.ENSP00000362403	0.525	Substance-K receptor
15	9606.ENSP00000319009	0.523	Transmembrane protein 45A
16	9606.ENSP00000362574	0.523	S100P binding protein
17	9606.ENSP00000354498	0.518	Pleckstrin homology like domain family B member 1
18	9606.ENSP00000283871	0.512	Homogentisate 1,2-dioxygenase
19	9606.ENSP00000440556	0.512	Metabotropic glutamate receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0009966	0.965	regulation of signal transduction
GO:0048519	0.954	negative regulation of biological process
GO:0051239	0.933	regulation of multicellular organismal process
GO:0099177	0.904	regulation of trans-synaptic signaling
GO:0050804	0.889	modulation of chemical synaptic transmission
GO:0031647	0.863	regulation of protein stability
GO:0044057	0.854	regulation of system process
GO:0031644	0.794	regulation of nervous system process
GO:0009987	0.779	cellular process
GO:0042391	0.504	regulation of membrane potential
GO:0098815	0.406	modulation of excitatory postsynaptic potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0031982	0.995	vesicle
GO:0031410	0.971	cytoplasmic vesicle
GO:0005773	0.944	vacuole
GO:0016020	0.941	membrane
GO:0005768	0.940	endosome
GO:0000323	0.905	lytic vacuole
GO:0005770	0.902	late endosome
GO:0005764	0.892	lysosome
GO:0071944	0.865	cell periphery
GO:0005886	0.836	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]