StarFunc result for job id Q86YH6

User Input

>input (399 residues)
MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIV
GYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLIS
KAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITD
DIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF
IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTS
AIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YH6	1.000	1.000	2.527E-57	399	1.000	1.000	Q86YH6.pdb.gz	DLP1_HUMAN All trans-polyprenyl-diphosphate synthase PDSS2 OS=Homo sapiens OX=9606 GN=PDSS2 PE=1 SV=2
2	AFDB:Q33DR3	0.935	0.930	1.838E-49	401	0.887	0.883	Q33DR3.pdb.gz	DLP1_MOUSE All trans-polyprenyl-diphosphate synthase PDSS2 OS=Mus musculus OX=10090 GN=Pdss2 PE=1 SV=2
3	AFDB:Q653T6	0.608	0.567	4.568E-15	430	0.266	0.247	Q653T6.pdb.gz	SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SPS1 PE=1 SV=1
4	AFDB:Q5HZ00	0.624	0.592	2.695E-14	422	0.253	0.239	Q5HZ00.pdb.gz	SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SPS3 PE=1 SV=1
5	AFDB:Q75HZ9	0.620	0.614	3.843E-14	403	0.228	0.226	Q75HZ9.pdb.gz	SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SPS2 PE=1 SV=2
6	AFDB:Q8S948	0.605	0.596	5.989E-14	406	0.218	0.214	Q8S948.pdb.gz	SPS1_ARATH Solanesyl diphosphate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS1 PE=1 SV=1
7	AFDB:Q76FS5	0.602	0.578	8.171E-14	417	0.226	0.216	Q76FS5.pdb.gz	SPS2_ARATH Solanesyl diphosphate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS2 PE=1 SV=1
8	AFDB:Q33DR2	0.599	0.585	9.334E-14	409	0.218	0.213	Q33DR2.pdb.gz	DPS1_MOUSE All trans-polyprenyl-diphosphate synthase PDSS1 OS=Mus musculus OX=10090 GN=Pdss1 PE=1 SV=1
9	AFDB:O43091	0.638	0.669	4.219E-13	378	0.231	0.243	O43091.pdb.gz	DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dps1 PE=1 SV=1
10	AFDB:Q5T2R2	0.601	0.579	8.581E-13	415	0.218	0.210	Q5T2R2.pdb.gz	DPS1_HUMAN All trans-polyprenyl-diphosphate synthase PDSS1 OS=Homo sapiens OX=9606 GN=PDSS1 PE=1 SV=1
11	PDB:5ze6A	0.608	0.753	6.295E-10	315	0.153	0.194	5ze6A.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
12	PDB:4gp2A	0.608	0.700	1.280E-9	342	0.153	0.178	4gp2A.pdb.gz	Crystal Structure of Isoprenoid Synthase from Pyrobaculum Calidifontis
13	PDB:3aqbD	0.594	0.713	3.552E-9	325	0.163	0.200	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
14	PDB:5zlfA	0.500	0.661	3.124E-8	293	0.148	0.201	5zlfA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
15	PDB:3ipiA	0.505	0.733	2.200E-7	268	0.140	0.209	3ipiA.pdb.gz
16	PDB:3pdeD	0.487	0.651	3.429E-7	291	0.153	0.210	3pdeD.pdb.gz	Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
17	PDB:2ftzA	0.447	0.650	6.974E-7	265	0.133	0.200	2ftzA.pdb.gz
18	PDB:5zlfB	0.466	0.700	2.885E-6	259	0.133	0.205	5zlfB.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
19	PDB:3lomA	0.433	0.586	5.369E-6	288	0.135	0.188	3lomA.pdb.gz
20	PDB:3ts7B	0.502	0.651	5.867E-6	297	0.163	0.219	3ts7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q33DR3	0.0	707	401	0.870	0.865	DLP1_MOUSE All trans-polyprenyl-diphosphate synthase PDSS2 OS=Mus musculus OX=10090 GN=Pdss2 PE=1 SV=2
2	Q86YH6	0.0	826	399	1.000	1.000	DLP1_HUMAN All trans-polyprenyl-diphosphate synthase PDSS2 OS=Homo sapiens OX=9606 GN=PDSS2 PE=1 SV=2
3	Q653T6	2.37e-33	131	430	0.238	0.221	SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SPS1 PE=1 SV=1
4	Q5HZ00	1.86e-32	128	422	0.236	0.223	SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SPS3 PE=1 SV=1
5	Q8S948	1.73e-27	114	406	0.231	0.227	SPS1_ARATH Solanesyl diphosphate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS1 PE=1 SV=1
6	Q75HZ9	3.59e-25	108	403	0.263	0.261	SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SPS2 PE=1 SV=2
7	Q76FS5	1.97e-24	106	417	0.221	0.211	SPS2_ARATH Solanesyl diphosphate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS2 PE=1 SV=1
8	O43091	1.38e-23	103	378	0.231	0.243	DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dps1 PE=1 SV=1
9	Q33DR2	6.82e-21	95.9	409	0.195	0.191	DPS1_MOUSE All trans-polyprenyl-diphosphate synthase PDSS1 OS=Mus musculus OX=10090 GN=Pdss1 PE=1 SV=1
10	Q5T2R2	1.50e-19	92.0	415	0.193	0.186	DPS1_HUMAN All trans-polyprenyl-diphosphate synthase PDSS1 OS=Homo sapiens OX=9606 GN=PDSS1 PE=1 SV=1
11	P18900	3.32e-19	91.3	473	0.203	0.171	COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ1 PE=1 SV=1
12	Q9V9Z3	2.69e-16	82.4	436	0.165	0.151	Q9V9Z3_DROME FI02023p OS=Drosophila melanogaster OX=7227 GN=qless PE=2 SV=2
13	P91093	8.25e-16	80.5	393	0.180	0.183	P91093_CAEEL Decaprenyl-diphosphate synthase subunit 2 OS=Caenorhabditis elegans OX=6239 GN=coq-1 PE=1 SV=2
14	O13851	4.40e-13	71.6	294	0.198	0.269	DLP1_SCHPO Decaprenyl-diphosphate synthase subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlp1 PE=1 SV=1
15	P31114	1.81e-11	67.0	348	0.188	0.216	HEPS2_BACSU Heptaprenyl diphosphate synthase component 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=hepT PE=1 SV=1
16	P55785	1.87e-11	67.0	320	0.190	0.237	HEPS2_GEOSE Heptaprenyl diphosphate synthase component 2 OS=Geobacillus stearothermophilus OX=1422 GN=hepT PE=3 SV=1
17	Q38EX7	3.06e-11	66.6	359	0.185	0.206	Q38EX7_TRYB2 Farnesyl pyrophosphate synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4300 PE=3 SV=1
18	Q8SY08	2.10e-10	62.8	245	0.103	0.167	Q8SY08_DROME RE18374p OS=Drosophila melanogaster OX=7227 GN=qless PE=2 SV=1
19	O06428	1.49e-05	48.9	335	0.083	0.099	NPPPS_MYCTU Nonaprenyl diphosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=grcC1 PE=1 SV=1
20	Q8PYS1	1.37e-04	45.8	295	0.148	0.200	GFPS_METMA Geranylfarnesyl diphosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_0789 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00348 polyprenyl_synt	8.7e-14	62.8	Polyprenyl synthetase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310873	0.995	4-hydroxybenzoate polyprenyltransferase, mitochondrial
2	9606.ENSP00000288532	0.958	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
3	9606.ENSP00000349078	0.958	Farnesyl pyrophosphate synthase
4	9606.ENSP00000282841	0.957	Geranylgeranyl pyrophosphate synthase
5	9606.ENSP00000333946	0.943	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
6	9606.ENSP00000366006	0.932	UbiA prenyltransferase domain-containing protein 1
7	9606.ENSP00000353104	0.930	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
8	9606.ENSP00000357480	0.922	Dehydrodolichyl diphosphate synthase complex subunit NUS1
9	9606.ENSP00000262507	0.918	Ubiquinone biosynthesis protein COQ9, mitochondrial
10	9606.ENSP00000246166	0.911	Protein farnesyltransferase subunit beta
11	9606.ENSP00000480828	0.909	Squalene synthase
12	9606.ENSP00000300452	0.906	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
13	9606.ENSP00000303423	0.905	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
14	9606.ENSP00000355741	0.899	Atypical kinase COQ8A, mitochondrial
15	9606.ENSP00000315118	0.886	Atypical kinase COQ8B, mitochondrial
16	9606.ENSP00000322316	0.876	5-demethoxyubiquinone hydroxylase, mitochondrial
17	9606.ENSP00000365388	0.875	Decaprenyl-diphosphate synthase subunit 1
18	9606.ENSP00000254759	0.869	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
19	9606.ENSP00000426638	0.805	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
20	9606.ENSP00000319240	0.720	Protein mago nashi homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004659	1.000	prenyltransferase activity
GO:0000010	0.959	trans-hexaprenyltranstransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.995	lipid metabolic process
GO:0006744	0.995	ubiquinone biosynthetic process
GO:0044255	0.993	cellular lipid metabolic process
GO:0008610	0.992	lipid biosynthetic process
GO:0008299	0.965	isoprenoid biosynthetic process
GO:0065007	0.415	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990234	0.999	transferase complex
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005829	0.934	cytosol
GO:0005759	0.536	mitochondrial matrix
GO:0016020	0.518	membrane
GO:0031981	0.353	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.
RHEA:27794	0.959	(2E,6E)-farnesyl diphosphate + 4 isopentenyl diphosphate = all-trans-heptaprenyl diphosphate + 4 diphosphate
EC:2.5.1.30	0.959	heptaprenyl diphosphate synthase.

[back to server]