StarFunc result for job id Q86YL7

User Input

>input (162 residues)
MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY
KSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTT
VEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YL7	0.999	0.999	3.005E-19	162	1.000	1.000	Q86YL7.pdb.gz	PDPN_HUMAN Podoplanin OS=Homo sapiens OX=9606 GN=PDPN PE=1 SV=3
2	AFDB:Q62011	0.488	0.462	1.122E-6	172	0.481	0.453	Q62011.pdb.gz	PDPN_MOUSE Podoplanin OS=Mus musculus OX=10090 GN=Pdpn PE=1 SV=2
3	AFDB:Q08054	0.219	0.122	2.612	341	0.191	0.091	Q08054.pdb.gz	CSI2_YEAST Chitin synthase 3 complex protein CSI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSI2 PE=1 SV=1
4	AFDB:P21917	0.181	0.077	9.256	419	0.160	0.062	P21917.pdb.gz	DRD4_HUMAN D(4) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD4 PE=1 SV=3
5	AFDB:Q9TYX9	0.162	0.052	9.256	665	0.117	0.029	Q9TYX9.pdb.gz	Q9TYX9_CAEEL SPK domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M57.1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YL7	8.09e-113	318	162	1.000	1.000	PDPN_HUMAN Podoplanin OS=Homo sapiens OX=9606 GN=PDPN PE=1 SV=3
2	Q62011	3.46e-36	125	172	0.481	0.453	PDPN_MOUSE Podoplanin OS=Mus musculus OX=10090 GN=Pdpn PE=1 SV=2
3	Q64294	2.05e-29	107	166	0.506	0.494	PDPN_RAT Podoplanin OS=Rattus norvegicus OX=10116 GN=Pdpn PE=1 SV=1
4	C0LGS3	0.12	34.7	768	0.130	0.027	Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana OX=3702 GN=At4g37250 PE=1 SV=1
5	D3Z941	0.43	33.1	902	0.105	0.019	D3Z941_RAT Methionine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mars1 PE=1 SV=1
6	F1R844	0.57	32.7	1342	0.105	0.013	F1R844_DANRE Neuropathy target esterase isoform X3 OS=Danio rerio OX=7955 GN=pnpla6 PE=3 SV=1
7	A1ZB91	1.1	31.6	540	0.105	0.031	DAAF3_DROME Dynein axonemal assembly factor 3 homolog OS=Drosophila melanogaster OX=7227 GN=Dnaaf3 PE=1 SV=1
8	A9CES5	1.1	31.6	329	0.148	0.073	TAGK_AGRFC Tagatose kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3166 PE=1 SV=1
9	P12576	1.1	32.0	2183	0.111	0.008	L_MEASE RNA-directed RNA polymerase L OS=Measles virus (strain Edmonston) OX=11235 GN=L PE=2 SV=1
10	Q68FL6	1.1	32.0	902	0.105	0.019	SYMC_MOUSE Methionine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Mars1 PE=1 SV=1
11	Q8N108	1.4	31.6	512	0.123	0.039	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
12	Q22618	1.5	31.2	495	0.117	0.038	DSRAD_CAEEL Double-stranded RNA-specific adenosine deaminase adr-2 OS=Caenorhabditis elegans OX=6239 GN=adr-2 PE=1 SV=2
13	Q9R100	1.5	31.6	827	0.093	0.018	CAD17_MOUSE Cadherin-17 OS=Mus musculus OX=10090 GN=Cdh17 PE=1 SV=1
14	P43298	1.8	31.2	942	0.105	0.018	TMK1_ARATH Receptor protein kinase TMK1 OS=Arabidopsis thaliana OX=3702 GN=TMK1 PE=1 SV=1
15	P34901	2.2	30.4	202	0.136	0.109	SDC4_RAT Syndecan-4 OS=Rattus norvegicus OX=10116 GN=Sdc4 PE=1 SV=1
16	Q95SP2	2.4	30.8	626	0.099	0.026	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
17	P97792	2.9	30.4	365	0.074	0.033	CXAR_MOUSE Coxsackievirus and adenovirus receptor homolog OS=Mus musculus OX=10090 GN=Cxadr PE=1 SV=1
18	P53075	3.2	30.4	577	0.148	0.042	SHE10_YEAST Outer spore wall assembly protein SHE10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHE10 PE=1 SV=1
19	Q9VE78	3.3	30.0	207	0.136	0.106	Q9VE78_DROME Corona OS=Drosophila melanogaster OX=7227 GN=cona PE=1 SV=2
20	Q24351	5.8	29.6	906	0.086	0.015	Q24351_DROME Glutamate receptor subunit OS=Drosophila melanogaster OX=7227 GN=GluRIIA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11174 DUF2970	1.4e+02	13.7	Protein of unknown function (DUF2970)
2	PF13273 DUF4064	37	16.0	Protein of unknown function (DUF4064)
3	PF15756 DUF4690	61	15.7	Small Novel Rich in Cartilage
4	PF17231 DUF5305	3.2e+02	12.3	Family of unknown function (DUF5305)
5	PF05808 Podoplanin	1.9e-55	198.3	Podoplanin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298527	0.999	C-type lectin domain family 1 member B
2	9606.ENSP00000356042	0.989	Ezrin
3	9606.ENSP00000259607	0.978	C-C motif chemokine 21
4	9606.ENSP00000371958	0.964	CD9 antigen
5	9606.ENSP00000256178	0.938	Lymphatic vessel endothelial hyaluronic acid receptor 1
6	9606.ENSP00000398632	0.923	CD44 antigen
7	9606.ENSP00000340944	0.915	Tyrosine-protein phosphatase non-receptor type 11
8	9606.ENSP00000364964	0.913	Inhibitory receptor that acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production (PubMed:12665801, PubMed:17311996, PubMed:27743390). Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide . This regulation of megakaryocate function as well as platelet production ann activation is done through the inhibition (via the 2 ITIM motifs) of the receptors CLEC1B and GP6:FcRgamma signaling . Appears to operate in a calcium-independent manner
9	9606.ENSP00000391592	0.906	Tyrosine-protein phosphatase non-receptor type 6
10	9606.ENSP00000435460	0.897	Galectin 8
11	9606.ENSP00000261937	0.842	Vascular endothelial growth factor receptor 3
12	9606.ENSP00000482457	0.813	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
13	9606.ENSP00000480043	0.809	Vascular endothelial growth factor C
14	9606.ENSP00000457421	0.807	Platelet endothelial cell adhesion molecule
15	9606.ENSP00000046794	0.792	Lymphocyte cytosolic protein 2
16	9606.ENSP00000364907	0.776	Tyrosine-protein kinase SYK
17	9606.ENSP00000281834	0.769	Tumor necrosis factor ligand superfamily member 4
18	9606.ENSP00000355925	0.769	Prospero homeobox protein 1
19	9606.ENSP00000325546	0.765	Zinc finger protein PLAG1
20	9606.ENSP00000360671	0.744	ADP/ATP translocase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051087	0.993	chaperone binding
GO:0005102	0.984	signaling receptor binding
GO:0019956	0.977	chemokine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.998	multicellular organismal process
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0022407	0.986	regulation of cell-cell adhesion
GO:0050896	0.985	response to stimulus
GO:0032502	0.985	developmental process
GO:0048856	0.983	anatomical structure development
GO:0030334	0.981	regulation of cell migration
GO:0048518	0.980	positive regulation of biological process
GO:0007165	0.977	signal transduction
GO:2000147	0.974	positive regulation of cell motility
GO:0051240	0.966	positive regulation of multicellular organismal process
GO:0034110	0.947	regulation of homotypic cell-cell adhesion
GO:0050865	0.921	regulation of cell activation
GO:0009653	0.907	anatomical structure morphogenesis
GO:0030335	0.903	positive regulation of cell migration
GO:0060429	0.889	epithelium development
GO:0010543	0.885	regulation of platelet activation
GO:0050793	0.869	regulation of developmental process
GO:0006950	0.865	response to stress
GO:0050817	0.864	coagulation
GO:0065008	0.855	regulation of biological quality
GO:0050878	0.854	regulation of body fluid levels
GO:0051128	0.822	regulation of cellular component organization
GO:0009611	0.811	response to wounding
GO:0042060	0.788	wound healing
GO:0007599	0.759	hemostasis
GO:0051094	0.709	positive regulation of developmental process
GO:1903053	0.682	regulation of extracellular matrix organization
GO:0048870	0.643	cell motility
GO:0016477	0.633	cell migration
GO:0035556	0.616	intracellular signal transduction
GO:0045785	0.578	positive regulation of cell adhesion
GO:0007264	0.572	small GTPase mediated signal transduction
GO:0007265	0.534	Ras protein signal transduction
GO:0002009	0.523	morphogenesis of an epithelium
GO:0007266	0.521	Rho protein signal transduction
GO:0001775	0.477	cell activation
GO:0022603	0.458	regulation of anatomical structure morphogenesis
GO:0045595	0.444	regulation of cell differentiation
GO:0090330	0.391	regulation of platelet aggregation
GO:0030168	0.385	platelet activation
GO:0120035	0.381	regulation of plasma membrane bounded cell projection organization
GO:0090504	0.381	epiboly
GO:0048519	0.365	negative regulation of biological process
GO:0010717	0.363	regulation of epithelial to mesenchymal transition
GO:1902743	0.357	regulation of lamellipodium organization
GO:0044319	0.357	wound healing, spreading of cells
GO:0051130	0.355	positive regulation of cellular component organization
GO:0022409	0.347	positive regulation of cell-cell adhesion
GO:0019222	0.343	regulation of metabolic process
GO:0007275	0.308	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0098590	0.987	plasma membrane region
GO:0005829	0.986	cytosol
GO:0031982	0.982	vesicle
GO:0098858	0.979	actin-based cell projection
GO:0016324	0.966	apical plasma membrane
GO:0030027	0.953	lamellipodium
GO:0031410	0.945	cytoplasmic vesicle
GO:0030175	0.939	filopodium
GO:0001726	0.918	ruffle
GO:0005739	0.912	mitochondrion
GO:0030054	0.898	cell junction
GO:0045121	0.863	membrane raft
GO:0045178	0.712	basal part of cell
GO:0005902	0.688	microvillus
GO:0016323	0.687	basolateral plasma membrane
GO:0031527	0.679	filopodium membrane
GO:0031258	0.678	lamellipodium membrane
GO:0097197	0.677	tetraspanin-enriched microdomain
GO:0061851	0.677	leading edge of lamellipodium
GO:0032587	0.571	ruffle membrane
GO:0031528	0.563	microvillus membrane
GO:0012505	0.468	endomembrane system
GO:0070013	0.412	intracellular organelle lumen
GO:0005634	0.352	nucleus
GO:0005576	0.351	extracellular region
GO:0043230	0.323	extracellular organelle
GO:0005654	0.303	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]