StarFunc result for job id Q86YM7

User Input

>input (354 residues)
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z214	0.542	0.525	1.571E-45	366	0.972	0.940	Q9Z214.pdb.gz	HOME1_RAT Homer protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Homer1 PE=1 SV=2
2	AFDB:B8JIC5	0.463	0.417	2.106E-38	398	0.757	0.673	B8JIC5.pdb.gz	B8JIC5_DANRE Homer protein homolog 1 isoform 1 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
3	AFDB:O88801	0.458	0.458	9.956E-30	354	0.523	0.523	O88801.pdb.gz	HOME2_RAT Homer protein homolog 2 OS=Rattus norvegicus OX=10116 GN=Homer2 PE=1 SV=1
4	AFDB:Q9NSC5	0.338	0.332	4.545E-29	361	0.500	0.490	Q9NSC5.pdb.gz	HOME3_HUMAN Homer protein homolog 3 OS=Homo sapiens OX=9606 GN=HOMER3 PE=1 SV=2
5	AFDB:B0JZL8	0.366	0.370	8.641E-29	350	0.503	0.509	B0JZL8.pdb.gz
6	AFDB:Q99JP6	0.342	0.340	4.182E-28	356	0.489	0.486	Q99JP6.pdb.gz	HOME3_MOUSE Homer protein homolog 3 OS=Mus musculus OX=10090 GN=Homer3 PE=1 SV=2
7	AFDB:Q502P2	0.359	0.405	6.673E-28	314	0.469	0.529	Q502P2.pdb.gz	Q502P2_DANRE Homer protein homolog 2 OS=Danio rerio OX=7955 GN=zgc:111960 PE=1 SV=1
8	AFDB:M9PEX1	0.327	0.290	5.243E-23	400	0.421	0.372	M9PEX1.pdb.gz	M9PEX1_DROME Homer, isoform G OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
9	AFDB:G5EG53	0.301	0.231	3.795E-10	468	0.116	0.088	G5EG53.pdb.gz	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1
10	AFDB:Q03173	0.315	0.147	9.113E-10	802	0.192	0.085	Q03173.pdb.gz	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
11	PDB:1k5dB	0.275	0.634	3.250E-7	146	0.068	0.164	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
12	PDB:3m1iB	0.277	0.706	6.944E-7	131	0.071	0.191	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
13	PDB:6am0F	0.236	0.447	9.150E-4	178	0.051	0.101	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
14	PDB:1q67B	0.245	0.500	1.090E-3	161	0.056	0.124	1q67B.pdb.gz
15	PDB:2qkmG	0.244	0.618	1.377E-3	127	0.056	0.157	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
16	PDB:4mk0A	0.240	0.143	1.844E-3	631	0.045	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:2kr0A	0.225	0.199	5.930E-3	407	0.037	0.032	2kr0A.pdb.gz
18	PDB:6oxlN	0.220	0.503	5.930E-3	124	0.054	0.153	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
19	PDB:3cm1A	0.188	0.371	1.600E-2	137	0.048	0.124	3cm1A.pdb.gz
20	PDB:4gouA	0.202	0.148	2.022E-2	507	0.045	0.032	4gouA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4INT7	0.0	537	360	0.763	0.750	A0A0R4INT7_DANRE Homer protein homolog 1 isoform 2 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
2	B8JIC5	0.0	530	398	0.757	0.673	B8JIC5_DANRE Homer protein homolog 1 isoform 1 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
3	Q86YM7	0.0	725	354	1.000	1.000	HOME1_HUMAN Homer protein homolog 1 OS=Homo sapiens OX=9606 GN=HOMER1 PE=1 SV=2
4	Q9Z214	0.0	703	366	0.975	0.943	HOME1_RAT Homer protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Homer1 PE=1 SV=2
5	Q9Z2Y3	0.0	710	366	0.986	0.954	HOME1_MOUSE Homer protein homolog 1 OS=Mus musculus OX=10090 GN=Homer1 PE=1 SV=2
6	Q9NSB8	7.67e-121	354	354	0.525	0.525	HOME2_HUMAN Homer protein homolog 2 OS=Homo sapiens OX=9606 GN=HOMER2 PE=1 SV=1
7	O88801	1.79e-120	353	354	0.520	0.520	HOME2_RAT Homer protein homolog 2 OS=Rattus norvegicus OX=10116 GN=Homer2 PE=1 SV=1
8	Q9QWW1	2.90e-120	353	354	0.523	0.523	HOME2_MOUSE Homer protein homolog 2 OS=Mus musculus OX=10090 GN=Homer2 PE=1 SV=1
9	Q9NSC5	6.47e-105	314	361	0.520	0.510	HOME3_HUMAN Homer protein homolog 3 OS=Homo sapiens OX=9606 GN=HOMER3 PE=1 SV=2
10	Q99JP6	8.63e-103	308	356	0.497	0.494	HOME3_MOUSE Homer protein homolog 3 OS=Mus musculus OX=10090 GN=Homer3 PE=1 SV=2
11	Q502P2	5.54e-100	300	314	0.494	0.557	Q502P2_DANRE Homer protein homolog 2 OS=Danio rerio OX=7955 GN=zgc:111960 PE=1 SV=1
12	Q0E8S7	2.88e-69	228	531	0.435	0.290	Q0E8S7_DROME Homer, isoform E OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=2
13	O96607	1.74e-58	196	394	0.395	0.355	O96607_DROME Homer OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
14	M9PB54	8.26e-57	191	397	0.390	0.348	M9PB54_DROME Homer, isoform F OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
15	M9PEX1	8.26e-57	191	400	0.390	0.345	M9PEX1_DROME Homer, isoform G OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
16	Q9VM94	1.61e-56	191	397	0.387	0.345	Q9VM94_DROME Homer, isoform B OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
17	Q5TJ65	1.11e-09	61.6	380	0.093	0.087	VASP_DICDI Protein VASP homolog OS=Dictyostelium discoideum OX=44689 GN=vasp PE=1 SV=1
18	A0A4D6J698	6.14e-09	59.7	570	0.116	0.072	A0A4D6J698_HUMAN Mena delta 11a OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q8N8S7	6.37e-09	59.7	591	0.116	0.069	ENAH_HUMAN Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2
20	A0A0G2K6I4	2.49e-08	57.8	563	0.113	0.071	A0A0G2K6I4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	2.8e+02	13.1	Autophagy protein 16 (ATG16)
2	PF10046 BLOC1_2	15	17.3	Biogenesis of lysosome-related organelles complex-1 subunit 2
3	PF19220 Crescentin	9.7	16.8	Crescentin protein
4	PF07889 DUF1664	1e+02	14.4	Protein of unknown function (DUF1664)
5	PF06160 EzrA	2.2	18.1	Septation ring formation regulator, EzrA
6	PF12018 FAP206	6.5e+02	11.1	Domain of unknown function
7	PF04632 FUSC	1.3e+02	12.7	Fusaric acid resistance protein family
8	PF13851 GAS	0.88	20.4	Growth-arrest specific micro-tubule binding
9	PF15905 HMMR_N	4.9	18.1	Hyaluronan mediated motility receptor N-terminal
10	PF00568 WH1	2.3e-31	119.4	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306138	0.998	Metabotropic glutamate receptor 5
2	9606.ENSP00000293441	0.995	SH3 and multiple ankyrin repeat domains protein 1
3	9606.ENSP00000354896	0.995	Metabotropic glutamate receptor 1
4	9606.ENSP00000469689	0.980	SH3 and multiple ankyrin repeat domains protein 2
5	9606.ENSP00000439937	0.977	Homer protein homolog 3
6	9606.ENSP00000305632	0.976	Homer protein homolog 2
7	9606.ENSP00000382428	0.976	Disks large homolog 4
8	9606.ENSP00000306253	0.952	Inositol 1,4,5-trisphosphate receptor type 1
9	9606.ENSP00000419313	0.932	Short transient receptor potential channel 1
10	9606.ENSP00000316377	0.923	Disks large-associated protein 1
11	9606.ENSP00000292385	0.882	Drebrin
12	9606.ENSP00000352447	0.876	Specifically androgen-regulated gene protein
13	9606.ENSP00000363435	0.856	Inositol 1,4,5-trisphosphate receptor type 3
14	9606.ENSP00000352608	0.854	Ryanodine receptor 1
15	9606.ENSP00000365745	0.845	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
16	9606.ENSP00000477455	0.831	Glutamate receptor ionotropic, NMDA 2B
17	9606.ENSP00000365272	0.815	Disks large homolog 2
18	9606.ENSP00000428994	0.808	Glutamate receptor 1
19	9606.ENSP00000362444	0.806	Disks large-associated protein 3
20	9606.ENSP00000356705	0.786	Dynamin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.719	identical protein binding
GO:0060090	0.712	molecular adaptor activity
GO:0005102	0.541	signaling receptor binding
GO:0035254	0.468	glutamate receptor binding
GO:0044877	0.407	protein-containing complex binding
GO:0001664	0.400	G protein-coupled receptor binding
GO:0044325	0.351	transmembrane transporter binding
GO:0035591	0.328	signaling adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007215	0.990	glutamate receptor signaling pathway
GO:0042221	0.965	response to chemical
GO:0007186	0.945	G protein-coupled receptor signaling pathway
GO:1902074	0.919	response to salt
GO:0023051	0.904	regulation of signaling
GO:0010646	0.903	regulation of cell communication
GO:0032409	0.874	regulation of transporter activity
GO:0034762	0.855	regulation of transmembrane transport
GO:0010033	0.842	response to organic substance
GO:0048583	0.822	regulation of response to stimulus
GO:1901700	0.817	response to oxygen-containing compound
GO:0022898	0.719	regulation of transmembrane transporter activity
GO:0048518	0.699	positive regulation of biological process
GO:0009966	0.608	regulation of signal transduction
GO:0032501	0.576	multicellular organismal process
GO:0010243	0.548	response to organonitrogen compound
GO:0048522	0.534	positive regulation of cellular process
GO:0032502	0.530	developmental process
GO:0042220	0.509	response to cocaine
GO:0048856	0.503	anatomical structure development
GO:0099177	0.501	regulation of trans-synaptic signaling
GO:0071840	0.484	cellular component organization or biogenesis
GO:0016043	0.456	cellular component organization
GO:0051179	0.419	localization
GO:0032412	0.410	regulation of monoatomic ion transmembrane transporter activity
GO:0034765	0.407	regulation of monoatomic ion transmembrane transport
GO:0050804	0.370	modulation of chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.995	organelle
GO:0005886	0.939	plasma membrane
GO:0043229	0.928	intracellular organelle
GO:0030054	0.845	cell junction
GO:0042995	0.725	cell projection
GO:0120025	0.724	plasma membrane bounded cell projection
GO:0043227	0.717	membrane-bounded organelle
GO:0043005	0.701	neuron projection
GO:0045202	0.698	synapse
GO:0098794	0.645	postsynapse
GO:0043231	0.617	intracellular membrane-bounded organelle
GO:0043232	0.572	intracellular non-membrane-bounded organelle
GO:0098978	0.420	glutamatergic synapse
GO:0099572	0.410	postsynaptic specialization
GO:0098984	0.368	neuron to neuron synapse
GO:0032279	0.358	asymmetric synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]