StarFunc result for job id Q86YN6

User Input

>input (1023 residues)
MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGE
LQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGD
ALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWR
QAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSP
RLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLP
QRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQDVLCDVSKPYR
LATPVYASLTPRSRPRPPKDSQASPGRPSSVEEVRIAASPKSTGPRPSLRPLRLEVKREV
RRPARLQQQEEEDEEEEEEEEEEEKEEEEEWGRKRPGRGLPWTKLGRKLESSVCPVRRSR
RLNPELGPWLTFADEPLVPSEPQGALPSLCLAPKAYDVERELGSPTDEDSGQDQQLLRGP
QIPALESPCESGCGDMDEDPSCPQLPPRDSPRCLMLALSQSDPTFGKKSFEQTLTVELCG
TAGLTPPTTPPYKPTEEDPFKPDIKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPE
RSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPSGVHLE
DWPQQGAPWAEAQAPGREEDRSCDAGAPPKDSTLLRDHEIRASLTKHFGLLETALEEEDL
ASCKSPEYDTVFEDSSSSSGESSFLPEEEEEEGEEEEEDDEEEDSGVSPTCSDHCPYQSP
PSKANRQLCSRSRSSSGSSPCHSWSPATRRNFRCESRGPCSDRTPSIRHARKRREKAIGE
GRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTK
GAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQ
SLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YN6	1.000	1.000	0.000	1023	1.000	1.000	Q86YN6.pdb.gz	PRGC2_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=2
2	AFDB:Q8VHJ7	0.182	0.183	0.000	1014	0.785	0.792	Q8VHJ7.pdb.gz	PRGC2_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Mus musculus OX=10090 GN=Ppargc1b PE=1 SV=1
3	AFDB:F1QXB5	0.090	0.107	1.126E-23	859	0.247	0.295	F1QXB5.pdb.gz
4	AFDB:A0A024R9Q9	0.091	0.113	5.204E-23	798	0.262	0.336	A0A024R9Q9.pdb.gz
5	AFDB:D7F2U9	0.085	0.103	1.263E-21	844	0.242	0.294	D7F2U9.pdb.gz
6	AFDB:Q5VV67	0.093	0.059	3.006E-17	1664	0.224	0.138	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
7	PDB:5vsuA	0.079	0.204	7.140E-6	387	0.020	0.052	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
8	PDB:6qx91K	0.076	0.353	8.645E-6	201	0.025	0.129	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
9	PDB:1hl6A	0.071	0.549	5.497E-5	119	0.016	0.134	1hl6A.pdb.gz
10	AFDB:H7C269	0.069	0.078	5.985E-5	906	0.117	0.132	H7C269.pdb.gz	H7C269_HUMAN Trinucleotide repeat containing adaptor 6A (Fragment) OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=1
11	PDB:6gd1A	0.076	0.355	6.656E-5	190	0.019	0.100	6gd1A.pdb.gz
12	AFDB:Q9JIX8	0.086	0.069	7.247E-5	1338	0.176	0.135	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
13	PDB:5oobB	0.078	0.455	1.109E-4	152	0.014	0.092	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
14	PDB:6g90B	0.076	0.357	1.109E-4	193	0.018	0.093	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
15	PDB:3lqvB	0.067	0.529	1.342E-4	115	0.020	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
16	PDB:5xjcw	0.075	0.731	1.342E-4	91	0.012	0.132	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
17	PDB:7dvqY	0.073	0.476	1.342E-4	140	0.015	0.107	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:5yzg1	0.070	0.280	1.968E-4	243	0.013	0.053	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	AFDB:Q9UKV3	0.081	0.064	3.142E-4	1341	0.162	0.124	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
20	AFDB:Q9P789	0.079	0.077	4.056E-4	1065	0.099	0.095	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y713	0.0	1358	748	0.661	0.904	H0Y713_HUMAN PPARG coactivator 1 beta (Fragment) OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=1
2	Q811R2	0.0	1373	1010	0.780	0.790	PRGC2_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Rattus norvegicus OX=10116 GN=Ppargc1b PE=2 SV=2
3	Q86YN6	0.0	2057	1023	1.000	1.000	PRGC2_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=2
4	Q8VHJ7	0.0	1357	1014	0.787	0.794	PRGC2_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Mus musculus OX=10090 GN=Ppargc1b PE=1 SV=1
5	Q9UBK2	1.42e-31	135	798	0.066	0.085	PRGC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Homo sapiens OX=9606 GN=PPARGC1A PE=1 SV=1
6	Q9QYK2	2.96e-31	134	796	0.065	0.084	PRGC1_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Rattus norvegicus OX=10116 GN=Ppargc1a PE=2 SV=1
7	O70343	6.57e-31	133	797	0.065	0.083	PRGC1_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Mus musculus OX=10090 GN=Ppargc1a PE=1 SV=1
8	E7EVG6	1.22e-30	133	1400	0.063	0.046	E7EVG6_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
9	X6R7H2	1.33e-30	131	631	0.062	0.100	X6R7H2_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
10	Q5VV67	1.80e-30	133	1664	0.063	0.038	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
11	Q8IPM0	1.13e-07	58.5	1058	0.030	0.029	Q8IPM0_DROME Spargel, isoform D OS=Drosophila melanogaster OX=7227 GN=srl PE=4 SV=3
12	Q5U183	1.23e-07	58.5	1058	0.030	0.029	Q5U183_DROME RE24187p OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=1
13	Q8IPM1	1.32e-07	58.5	1067	0.030	0.029	Q8IPM1_DROME FI18188p1 OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=2
14	Q8IH74	4.46e-06	53.1	555	0.026	0.049	Q8IH74_DROME GH02708p OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=1
15	M9PDB0	8.01e-04	45.8	573	0.022	0.038	M9PDB0_DROME Bruno 1, isoform H OS=Drosophila melanogaster OX=7227 GN=bru1 PE=3 SV=1
16	O02374	0.001	45.4	604	0.022	0.036	O02374_DROME Bruno OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
17	O18409	0.001	45.8	808	0.022	0.027	O18409_DROME Testis-specific RNP-type RNA binding protein OS=Drosophila melanogaster OX=7227 GN=bru1 PE=1 SV=1
18	Q8IP89	0.001	45.4	620	0.022	0.035	Q8IP89_DROME Bruno 1, isoform F OS=Drosophila melanogaster OX=7227 GN=bru1 PE=3 SV=2
19	Q8IP90	0.001	45.8	810	0.022	0.027	Q8IP90_DROME Bruno 1, isoform B OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
20	Q960Z4	0.001	45.4	604	0.022	0.036	Q960Z4_DROME Bruno 1, isoform A OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05432 BSP_II	8.3e+02	11.1	Bone sialoprotein II (BSP-II)
2	PF09747 CCD97-like_C	23	16.6	Coiled-coil domain containing protein 97-like, C-terminal
3	PF00076 RRM_1	0.00011	33.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384851	0.960	Steroid hormone receptor ERR1
2	9606.ENSP00000348069	0.922	Sterol regulatory element-binding protein 1
3	9606.ENSP00000380888	0.920	Mediator of RNA polymerase II transcription subunit 13
4	9606.ENSP00000307786	0.918	Cytochrome c
5	9606.ENSP00000262030	0.911	ATP synthase subunit beta, mitochondrial
6	9606.ENSP00000360493	0.906	Runt-related transcription factor 2
7	9606.ENSP00000378416	0.903	5-aminolevulinate synthase, nonspecific, mitochondrial
8	9606.ENSP00000251871	0.900	Mediator of RNA polymerase II transcription subunit 17
9	9606.ENSP00000258648	0.900	Mediator of RNA polymerase II transcription subunit 4
10	9606.ENSP00000263390	0.900	Mediator of RNA polymerase II transcription subunit 26
11	9606.ENSP00000282892	0.900	Mediator of RNA polymerase II transcription subunit 21
12	9606.ENSP00000290663	0.900	Mediator of RNA polymerase II transcription subunit 8
13	9606.ENSP00000293777	0.900	Mediator of RNA polymerase II transcription subunit 11
14	9606.ENSP00000297347	0.900	Mediator of RNA polymerase II transcription subunit 30
15	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
16	9606.ENSP00000314343	0.900	Mediator of RNA polymerase II transcription subunit 29
17	9606.ENSP00000323720	0.900	Mediator of RNA polymerase II transcription subunit 14
18	9606.ENSP00000325612	0.900	Mediator of RNA polymerase II transcription subunit 16
19	9606.ENSP00000346634	0.900	Thyroid hormone receptor-associated protein 3
20	9606.ENSP00000362948	0.900	Mediator of RNA polymerase II transcription subunit 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.992	transcription regulator activity
GO:0008134	0.978	transcription factor binding
GO:0003713	0.961	transcription coactivator activity
GO:0061629	0.956	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.937	nuclear receptor binding
GO:0030331	0.894	nuclear estrogen receptor binding
GO:0030374	0.890	nuclear receptor coactivator activity
GO:0019904	0.883	protein domain specific binding
GO:0097159	0.799	organic cyclic compound binding
GO:0003676	0.792	nucleic acid binding
GO:0050682	0.631	AF-2 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0006355	0.977	regulation of DNA-templated transcription
GO:0010557	0.976	positive regulation of macromolecule biosynthetic process
GO:0031328	0.976	positive regulation of cellular biosynthetic process
GO:0045893	0.967	positive regulation of DNA-templated transcription
GO:0051716	0.956	cellular response to stimulus
GO:0070887	0.950	cellular response to chemical stimulus
GO:0048545	0.909	response to steroid hormone
GO:0007154	0.896	cell communication
GO:0023052	0.891	signaling
GO:0007165	0.884	signal transduction
GO:0006357	0.882	regulation of transcription by RNA polymerase II
GO:0045944	0.864	positive regulation of transcription by RNA polymerase II
GO:0071310	0.795	cellular response to organic substance
GO:0071495	0.794	cellular response to endogenous stimulus
GO:0030522	0.699	intracellular receptor signaling pathway
GO:0032870	0.681	cellular response to hormone stimulus
GO:0008152	0.627	metabolic process
GO:0009755	0.609	hormone-mediated signaling pathway
GO:0071383	0.572	cellular response to steroid hormone stimulus
GO:0071704	0.561	organic substance metabolic process
GO:0044238	0.493	primary metabolic process
GO:0006807	0.432	nitrogen compound metabolic process
GO:0030518	0.430	intracellular steroid hormone receptor signaling pathway
GO:0044237	0.384	cellular metabolic process
GO:0048519	0.359	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.998	cytosol
GO:0032991	0.995	protein-containing complex
GO:0140513	0.962	nuclear protein-containing complex
GO:0016592	0.899	mediator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]