StarFunc result for job id Q86YR7

User Input

>input (1114 residues)
MLSCLKEEMPPQELTRRLATVITHVDEIMQQEVRPLMAVEIIEQLHRQFAILSGGRGEDG
APIITFPEFSGFKHIPDEDFLNVMTYLTSIPSVEAASIGFIVVIDRRRDKWSSVKASLTR
IAVAFPGNLQLIFILRPSRFIQRTFTDIGIKYYRNEFKTKVPIIMVNSVSDLHGYIDKSQ
LTRELGGTLEYRHGQWVNHRTAIENFALTLKTTAQMLQTFGSCLATAELPRSMLSTEDLL
MSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDE
TEKAFSHFWSEHHLKLNQCLQLQHFEHDFCKAKLALDNLLEEQAEFTGIGDSVMHVEQIL
KEHKKLEEKSQEPLEKAQLLALVGDQLIQSHHYAADAIRPRCVELRHLCDDFINGNKKKW
DILGKSLEFHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDIALNDIATFLGTVKEYPL
LSPKEFYNEFELLLTLDAKAKAQKVLQRLDDVQEIFHKRQVSLMKLAAKQTRPVQPVAPH
PESSPKWVSSKTSQPSTSVPLARPLRTSEEPYTETELNSRGKEDDETKFEVKSEEIFESH
HERGNPELEQQARLGDLSPRRRIIRDLLETEEIYIKEIKSIIDGYITPMDFIWLKHLIPD
VLQNNKDFLFGNIRELYEFHNRTFLKELEKCAENPELLAHCFLKRKEDLQIYFKYHKNLP
RARAIWQECQDCAYFGVCQRQLDHNLPLFKYLKGPSQRLIKYQMLLKGLLDFESPEDMEI
DPGELGGSAKDGPKRTKDSAFSTELQQALAVIEDLIKSCELAVDLAAVTECPDDIGKLGK
LLLHGPFSVWTIHKDRYKMKDLIRFKPSQRQIYLFERGIVFCKIRMEPGDQGLSPHYSFK
KTMKLMTLSIRQLGRGSHRKFEIASRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNI
KDQGNPQFEMSTSKGSGAGSGPWIKNMERATTSKEDPASSTGGIKGCSSREFSSMDTFED
CEGAEDMEKESSALSLAGLFQSDDSHETCSSKSAFLERGESSQGEKEERDEEETATRSTE
EERAGASTGRLAPAGATAGFQARALRPRTSAQES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63406	0.467	0.453	3.238E-72	1149	0.408	0.396	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
2	AFDB:O15068	0.468	0.459	5.799E-72	1137	0.399	0.391	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
3	AFDB:Q8BLE2	0.431	0.462	2.268E-61	1031	0.326	0.352	Q8BLE2.pdb.gz	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
4	AFDB:H2KYI7	0.424	0.446	5.542E-47	1055	0.224	0.236	H2KYI7.pdb.gz	H2KYI7_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cgef-1 PE=4 SV=2
5	AFDB:A0A2R8RHL8	0.350	0.175	1.602E-29	2306	0.246	0.119	A0A2R8RHL8.pdb.gz	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
6	AFDB:A0A0R4I9W4	0.310	0.217	6.240E-28	1632	0.224	0.153	A0A0R4I9W4.pdb.gz
7	AFDB:Q9H7P9	0.215	0.178	8.987E-18	1386	0.100	0.080	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
8	PDB:4mt6A	0.183	0.403	1.290E-11	389	0.066	0.188	4mt6A.pdb.gz
9	PDB:7rx9A	0.147	0.361	1.956E-11	432	0.066	0.171	7rx9A.pdb.gz
10	AFDB:Q9Y7U6	0.194	0.167	2.553E-8	1334	0.055	0.046	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
11	AFDB:P53046	0.178	0.174	3.144E-8	1155	0.062	0.060	P53046.pdb.gz	ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROM1 PE=1 SV=2
12	AFDB:A4QPE4	0.187	0.217	4.386E-8	934	0.092	0.109	A4QPE4.pdb.gz	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
13	PDB:4gouA	0.145	0.302	2.552E-6	507	0.067	0.148	4gouA.pdb.gz
14	PDB:4mk0A	0.090	0.149	4.448E-4	631	0.038	0.067	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:1sjjA	0.158	0.193	1.313E-3	863	0.054	0.070	1sjjA.pdb.gz
16	PDB:3w68C	0.129	0.470	1.831E-3	252	0.030	0.131	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
17	PDB:5yqrA	0.081	0.276	2.351E-3	268	0.029	0.119	5yqrA.pdb.gz
18	PDB:3pvuA	0.085	0.143	3.715E-3	609	0.039	0.071	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:4cizA	0.127	0.439	3.873E-3	284	0.031	0.123	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
20	PDB:3b7nA	0.112	0.347	7.859E-3	307	0.031	0.114	3b7nA.pdb.gz	Functional anatomy of phospholipid binding and regulation of phosphoinositide homeostasis by proteins of the sec14 superfamily

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15068	0.0	845	1137	0.389	0.381	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
2	P10911	0.0	564	925	0.288	0.347	MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens OX=9606 GN=MCF2 PE=1 SV=3
3	Q63406	0.0	841	1149	0.388	0.376	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
4	Q64096	0.0	833	1149	0.385	0.373	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
5	Q6PDM6	0.0	846	1166	0.390	0.372	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
6	Q8BLE2	0.0	614	1031	0.314	0.339	Q8BLE2_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
7	Q99N72	1.32e-177	546	928	0.285	0.342	Q99N72_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=1 SV=1
8	A2AET8	6.37e-177	545	944	0.284	0.335	A2AET8_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=4 SV=1
9	Q8C067	1.36e-176	544	928	0.284	0.341	Q8C067_MOUSE Mcf.2 transforming sequence OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
10	Q7TNJ5	2.07e-176	544	944	0.284	0.335	Q7TNJ5_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1
11	H2KYI7	7.86e-99	339	1055	0.232	0.245	H2KYI7_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cgef-1 PE=4 SV=2
12	O75962	2.06e-43	176	3097	0.162	0.058	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
13	Q0KL02	9.05e-43	173	3102	0.162	0.058	TRIO_MOUSE Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3
14	F1M0Z1	1.19e-42	173	3100	0.162	0.058	TRIO_RAT Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4
15	A2CG49	2.77e-41	169	2964	0.109	0.041	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1
16	H7BXZ5	1.48e-40	166	2955	0.108	0.041	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
17	O60229	1.68e-40	166	2986	0.108	0.040	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
18	P97924	7.87e-40	164	2959	0.107	0.040	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3
19	Q86VW2	4.38e-39	156	580	0.096	0.184	ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens OX=9606 GN=ARHGEF25 PE=1 SV=2
20	Q9CWR0	2.33e-37	152	618	0.092	0.167	ARHGP_MOUSE Rho guanine nucleotide exchange factor 25 OS=Mus musculus OX=10090 GN=Arhgef25 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	69	14.7	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	2.8e-07	42.3	Divergent CRAL/TRIO domain
3	PF00169 PH	1.4	20.8	PH domain
4	PF15411 PH_10	38	16.0	Pleckstrin homology domain
5	PF00621 RhoGEF	2.5e-20	85.0	RhoGEF domain
6	PF00435 Spectrin	1.2	21.0	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344961	0.814	Pleckstrin homology and RhoGEF domain containing G7
2	9606.ENSP00000404705	0.746	Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
3	9606.ENSP00000417659	0.726	Protein phosphatase 1L
4	9606.ENSP00000341342	0.683	Kelch-like protein 6
5	9606.ENSP00000296015	0.677	Belongs to the TTC14 family
6	9606.ENSP00000316173	0.651	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
7	9606.ENSP00000264674	0.625	MDS1 and EVI1 complex locus protein EVI1
8	9606.ENSP00000367638	0.596	Rho guanine nucleotide exchange factor 39
9	9606.ENSP00000333926	0.594	Multidrug resistance-associated protein 5
10	9606.ENSP00000343273	0.594	Kelch-like protein 7
11	9606.ENSP00000427123	0.583	Ankycorbin
12	9606.ENSP00000306983	0.558	YEATS domain-containing protein 2
13	9606.ENSP00000355026	0.557	Rho guanine nucleotide exchange factor 15
14	9606.ENSP00000413228	0.556	Putative uncharacterized protein PQLC2L
15	9606.ENSP00000368637	0.553	Solute carrier family 23 member 2
16	9606.ENSP00000321195	0.551	Probable phospholipid-transporting ATPase IF
17	9606.ENSP00000442307	0.530	Epithelial cell-transforming sequence 2 oncogene-like
18	9606.ENSP00000441913	0.528	Rho guanine nucleotide exchange factor 28
19	9606.ENSP00000265594	0.522	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
20	9606.ENSP00000315659	0.522	Dynamin-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0035091	0.866	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.942	response to stimulus
GO:0051056	0.914	regulation of small GTPase mediated signal transduction
GO:0051716	0.731	cellular response to stimulus
GO:0048518	0.699	positive regulation of biological process
GO:0042221	0.663	response to chemical
GO:0048522	0.608	positive regulation of cellular process
GO:0048856	0.550	anatomical structure development
GO:0048584	0.542	positive regulation of response to stimulus
GO:0007275	0.398	multicellular organism development
GO:0010647	0.394	positive regulation of cell communication
GO:0023056	0.392	positive regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0005829	0.979	cytosol
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005634	0.873	nucleus
GO:0071944	0.869	cell periphery
GO:0070013	0.810	intracellular organelle lumen
GO:0005886	0.750	plasma membrane
GO:0031981	0.687	nuclear lumen
GO:0005654	0.628	nucleoplasm
GO:0019898	0.345	extrinsic component of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]