StarFunc result for job id Q86YS7

User Input

>input (1000 residues)
MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEV
DDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRG
EINVVVKVDLFNDLNRFRQSSCGVKFFCTTSIPKCYRAVIIHGFVEELVVNEDPEYQWID
RIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACNSPSKEMKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSY
SRQSSSSDTDLSLTPKTGMGSGSAGKEGGPFKALLRQQTQSALEQREFPFFTLTAFPPGF
LVHVGGVVSARSVKLLDRIHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSI
CEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFCHIPYDELNMPFPAHL
TYCYNCRKQKVPDVLFTTIDLPTDATVIGKGCLIQARLCRLKKKAQAEANATAISNLLPF
MEYEVHTQLMNKLKLKGMNALFGLRIQITVGENMLMGLASATGVYLAALPTPGGIQIAGK
TPNDGSYEQHISHMQKKINDTIAKNKELYEINPPEISEEIIGSPIPEPRQRSRLLRSQSE
SSDEVTELDLSHGKKDAFVLEIDDTDAMEDVHSLLTDVPPPSGFYSCNTEIMPGINNWTS
EIQMFTSVRVIRLSSLNLTNQALNKNFNDLCENLLKSLYFKLRSMIPCCLCHVNFTVSLP
EDELIQVTVTAVAITFDKNQALQTTKTPVEKSLQRASTDNEELLQFPLELCSDSLPSHPF
PPAKAMTVEKASPVGDGNFRNRSAPPCANSTVGVVKMTPLSFIPGAKITKYLGIINMFFI
RETTSLREEGGVSGFLHAFIAEVFAMVRAHVAALGGNAVVSYIMKQCVFMENPNKNQAQC
LINVSGDAVVFVRESDLEVVSSQQPTTNCQSSCTEGEVTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TPS5	0.941	0.927	0.000	1016	0.961	0.946	Q7TPS5.pdb.gz	C2CD5_MOUSE C2 domain-containing protein 5 OS=Mus musculus OX=10090 GN=C2cd5 PE=1 SV=2
2	AFDB:Q386A0	0.680	0.556	2.063E-74	1235	0.266	0.215	Q386A0.pdb.gz	Q386A0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1630 PE=4 SV=1
3	AFDB:H3BS47	0.117	0.094	1.147E-9	1253	0.066	0.053	H3BS47.pdb.gz	H3BS47_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
4	AFDB:E1BJB4	0.117	0.093	3.400E-9	1270	0.064	0.050	E1BJB4.pdb.gz	E1BJB4_BOVIN RPGRIP1 like OS=Bos taurus OX=9913 GN=RPGRIP1L PE=1 SV=3
5	AFDB:Q93XX4	0.115	0.151	6.524E-9	751	0.057	0.076	Q93XX4.pdb.gz	C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana OX=3702 GN=NTMC2T6.1 PE=1 SV=2
6	PDB:4rj9A	0.111	0.602	1.166E-8	161	0.040	0.248	4rj9A.pdb.gz
7	AFDB:Q52KB6	0.118	0.058	1.252E-8	2323	0.126	0.054	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
8	PDB:5a50A	0.113	0.632	1.800E-8	165	0.037	0.224	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
9	AFDB:X2JEA7	0.118	0.273	2.827E-8	420	0.058	0.138	X2JEA7.pdb.gz	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
10	PDB:5a52A	0.113	0.676	2.935E-8	154	0.033	0.214	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
11	AFDB:Q4AC94	0.123	0.061	2.985E-8	2353	0.116	0.049	Q4AC94.pdb.gz	C2CD3_HUMAN C2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=C2CD3 PE=1 SV=4
12	AFDB:E7F4H1	0.119	0.058	3.151E-8	2097	0.045	0.021	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
13	AFDB:Q03640	0.117	0.077	3.916E-8	1545	0.066	0.043	Q03640.pdb.gz	TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TCB3 PE=1 SV=1
14	PDB:5iz5B	0.116	0.153	9.181E-8	746	0.038	0.051	5iz5B.pdb.gz
15	PDB:5ixcA	0.111	0.160	1.860E-7	684	0.030	0.044	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5iz5A	0.113	0.146	2.440E-7	757	0.036	0.048	5iz5A.pdb.gz
17	PDB:3nsjA	0.105	0.193	4.435E-7	530	0.028	0.053	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
18	PDB:5izrC	0.109	0.163	5.819E-7	659	0.031	0.047	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:3pfqA	0.082	0.153	1.547E-6	523	0.029	0.055	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:1cjyA	0.112	0.173	6.348E-6	633	0.026	0.041	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TPS5	0.0	1957	1016	0.962	0.947	C2CD5_MOUSE C2 domain-containing protein 5 OS=Mus musculus OX=10090 GN=C2cd5 PE=1 SV=2
2	Q86YS7	0.0	2080	1000	1.000	1.000	C2CD5_HUMAN C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1
3	H0YGU7	5.49e-94	297	182	0.148	0.813	H0YGU7_HUMAN C2 calcium dependent domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1
4	Q386A0	1.91e-49	193	1235	0.147	0.119	Q386A0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1630 PE=4 SV=1
5	Q66VB0	1.98e-09	64.3	1086	0.036	0.033	Q66VB0_ORYSJ No pollen OS=Oryza sativa subsp. japonica OX=39947 PE=2 SV=1
6	Q9SKA3	3.97e-09	63.2	1029	0.045	0.044	MCTP6_ARATH Multiple C2 domain and transmembrane region protein 6 OS=Arabidopsis thaliana OX=3702 GN=MCTP6 PE=2 SV=1
7	Q9LVH4	5.03e-09	58.9	177	0.052	0.294	CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=CAR4 PE=1 SV=1
8	Q6YWF1	6.15e-09	58.5	165	0.035	0.212	GAP1_ORYSJ GTPase activating protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=GAP1 PE=1 SV=1
9	Q8LFN9	4.05e-08	58.5	336	0.045	0.134	AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana OX=3702 GN=AGD13 PE=2 SV=1
10	Q9SSL1	9.28e-08	55.1	165	0.032	0.194	CAR7_ARATH Protein C2-DOMAIN ABA-RELATED 7 OS=Arabidopsis thaliana OX=3702 GN=CAR7 PE=1 SV=1
11	Q9FIK8	1.57e-07	54.3	166	0.033	0.199	CAR11_ARATH Protein C2-DOMAIN ABA-RELATED 11 OS=Arabidopsis thaliana OX=3702 GN=CAR11 PE=1 SV=1
12	Q9FHP6	2.05e-07	53.9	168	0.031	0.185	CAR1_ARATH Protein C2-DOMAIN ABA-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=CAR1 PE=1 SV=1
13	Q9S764	2.49e-07	53.9	174	0.028	0.161	CAR6_ARATH Protein C2-DOMAIN ABA-RELATED 6 OS=Arabidopsis thaliana OX=3702 GN=CAR6 PE=1 SV=1
14	O43374	3.72e-07	56.6	803	0.036	0.045	RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=RASA4 PE=2 SV=2
15	Q9M2D4	4.91e-07	56.2	972	0.035	0.036	MCTP8_ARATH Multiple C2 domain and transmembrane region protein 8 OS=Arabidopsis thaliana OX=3702 GN=MCTP8 PE=2 SV=1
16	Q9ZVF1	5.07e-07	53.1	180	0.030	0.167	CAR10_ARATH Protein C2-DOMAIN ABA-RELATED 10 OS=Arabidopsis thaliana OX=3702 GN=CAR10 PE=2 SV=1
17	Q6DN14	6.77e-07	55.8	999	0.030	0.030	MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MCTP1 PE=2 SV=2
18	Q84TJ7	6.91e-07	55.8	1011	0.047	0.046	MCTP7_ARATH Multiple C2 domain and transmembrane region protein 7 OS=Arabidopsis thaliana OX=3702 GN=MCTP7 PE=2 SV=1
19	D4ABL6	7.77e-07	55.8	946	0.030	0.032	MCTP1_RAT Multiple C2 and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Mctp1 PE=1 SV=4
20	Q9LP65	1.04e-06	52.8	200	0.032	0.160	CAR5_ARATH Protein C2-DOMAIN ABA-RELATED 5 OS=Arabidopsis thaliana OX=3702 GN=CAR5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.1e-19	81.1	C2 domain
2	PF01906 YbjQ_1	0.29	23.1	Putative heavy-metal-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000008137

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000006722	0.930	Fibroblast growth factor (Acidic) intracellular binding protein
2	9598.ENSPTRP00000034032	0.789	Cyclin-dependent kinase 5
3	9598.ENSPTRP00000018854	0.646	V-akt murine thymoma viral oncogene homolog 2
4	9598.ENSPTRP00000032640	0.594	Uncharacterized protein
5	9598.ENSPTRP00000052565	0.561	Iron-sulfur cluster assembly 2 homolog
6	9598.ENSPTRP00000046511	0.555	Exocyst complex component 5
7	9598.ENSPTRP00000041760	0.554	Exocyst complex component 1
8	9598.ENSPTRP00000014542	0.552	Myosin IC
9	9598.ENSPTRP00000011079	0.535	Ectonucleoside triphosphate diphosphohydrolase 5
10	9598.ENSPTRP00000044919	0.531	EH domain binding protein 1
11	9598.ENSPTRP00000033958	0.508	Thiamin pyrophosphokinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.986	response to stimulus
GO:0045184	0.981	establishment of protein localization
GO:0071495	0.979	cellular response to endogenous stimulus
GO:0033043	0.979	regulation of organelle organization
GO:0060627	0.979	regulation of vesicle-mediated transport
GO:1901701	0.978	cellular response to oxygen-containing compound
GO:0071310	0.978	cellular response to organic substance
GO:0010243	0.976	response to organonitrogen compound
GO:0048518	0.974	positive regulation of biological process
GO:0071840	0.973	cellular component organization or biogenesis
GO:1901653	0.972	cellular response to peptide
GO:0031338	0.970	regulation of vesicle fusion
GO:0071705	0.968	nitrogen compound transport
GO:0071702	0.968	organic substance transport
GO:0009725	0.967	response to hormone
GO:0016043	0.964	cellular component organization
GO:0051050	0.962	positive regulation of transport
GO:0048522	0.959	positive regulation of cellular process
GO:0032880	0.957	regulation of protein localization
GO:0032869	0.955	cellular response to insulin stimulus
GO:1905475	0.949	regulation of protein localization to membrane
GO:0010638	0.931	positive regulation of organelle organization
GO:0023052	0.920	signaling
GO:0051223	0.920	regulation of protein transport
GO:0007154	0.914	cell communication
GO:0033157	0.905	regulation of intracellular protein transport
GO:0072657	0.864	protein localization to membrane
GO:0015031	0.860	protein transport
GO:0016192	0.826	vesicle-mediated transport
GO:0006996	0.793	organelle organization
GO:0051222	0.773	positive regulation of protein transport
GO:0007165	0.772	signal transduction
GO:0007166	0.721	cell surface receptor signaling pathway
GO:0007167	0.710	enzyme-linked receptor protein signaling pathway
GO:1903533	0.706	regulation of protein targeting
GO:0090316	0.706	positive regulation of intracellular protein transport
GO:0007169	0.660	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0034762	0.583	regulation of transmembrane transport
GO:1905477	0.522	positive regulation of protein localization to membrane
GO:0006886	0.480	intracellular protein transport
GO:0034764	0.460	positive regulation of transmembrane transport
GO:0061024	0.434	membrane organization
GO:0055085	0.431	transmembrane transport
GO:0008286	0.392	insulin receptor signaling pathway
GO:0048284	0.359	organelle fusion
GO:0010827	0.330	regulation of glucose transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.995	cytoplasm
GO:0005829	0.994	cytosol
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0098590	0.979	plasma membrane region
GO:0031090	0.979	organelle membrane
GO:0030659	0.971	cytoplasmic vesicle membrane
GO:0012505	0.956	endomembrane system
GO:0043232	0.920	intracellular non-membrane-bounded organelle
GO:0032991	0.777	protein-containing complex
GO:0015630	0.579	microtubule cytoskeleton
GO:0120025	0.549	plasma membrane bounded cell projection
GO:0031253	0.512	cell projection membrane
GO:0005938	0.504	cell cortex
GO:0032587	0.503	ruffle membrane
GO:0005815	0.330	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]