StarFunc result for job id Q86YT6

User Input

>input (1006 residues)
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
GNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
KLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNK
GHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNAL
HHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLD
IQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQD
MQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLC
PDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQC
RAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ
TMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZUV2	0.388	0.388	0.000	1006	0.987	0.987	D3ZUV2.pdb.gz	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
2	AFDB:Q804S5	0.412	0.403	0.000	1030	0.940	0.918	Q804S5.pdb.gz	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
3	AFDB:Q9VUX2	0.344	0.284	0.000	1226	0.697	0.572	Q9VUX2.pdb.gz	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
4	AFDB:A0AR23	0.353	0.356	1.583E-89	999	0.393	0.395	A0AR23.pdb.gz	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
5	AFDB:Q8R516	0.338	0.348	2.996E-87	973	0.388	0.401	Q8R516.pdb.gz	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
6	AFDB:Q9VJ14	0.311	0.299	8.826E-80	1049	0.367	0.352	Q9VJ14.pdb.gz	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
7	AFDB:A0A0G2KXP0	0.351	0.393	2.743E-60	889	0.316	0.358	A0A0G2KXP0.pdb.gz
8	PDB:8cs9A	0.267	0.332	2.958E-21	796	0.106	0.134	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	AFDB:P16157	0.251	0.142	5.010E-21	1881	0.105	0.056	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
10	AFDB:E9Q9B7	0.256	0.153	6.401E-21	1793	0.111	0.062	E9Q9B7.pdb.gz	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
11	AFDB:O75179	0.206	0.094	1.210E-20	2603	0.116	0.045	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
12	PDB:5vkqA	0.259	0.179	3.113E-15	1499	0.095	0.064	5vkqA.pdb.gz
13	PDB:2dvwA	0.175	0.620	4.179E-14	229	0.074	0.323	2dvwA.pdb.gz
14	PDB:4oauC	0.235	0.329	7.524E-14	692	0.090	0.132	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6v9hC	0.173	0.498	1.229E-10	270	0.069	0.256	6v9hC.pdb.gz
16	PDB:1wg0A	0.185	0.670	1.820E-10	243	0.062	0.255	1wg0A.pdb.gz
17	PDB:6aunA	0.185	0.287	2.325E-10	618	0.064	0.104	6aunA.pdb.gz
18	PDB:6pqpA	0.187	0.294	1.292E-9	615	0.062	0.101	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6jd6B	0.153	0.718	5.900E-9	192	0.054	0.281	6jd6B.pdb.gz
20	PDB:6v9xA	0.199	0.337	2.830E-8	571	0.067	0.117	6v9xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0AR23	0.0	700	999	0.404	0.406	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
2	D3ZUV2	0.0	2066	1006	0.992	0.992	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
3	Q804S5	0.0	1973	1030	0.941	0.919	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
4	Q80SY4	0.0	2068	1006	0.993	0.993	MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1
5	Q86YT6	0.0	2082	1006	1.000	1.000	MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1
6	Q8R516	0.0	646	973	0.382	0.395	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
7	Q96AX9	0.0	650	955	0.387	0.407	MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2 PE=1 SV=4
8	Q9VUX2	0.0	1330	1226	0.653	0.536	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
9	Q9VJ14	5.20e-170	527	1049	0.300	0.288	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
10	O70511	7.51e-34	144	2622	0.095	0.037	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
11	G5E8K5	2.51e-33	142	1961	0.096	0.049	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
12	O88521	6.10e-33	140	1762	0.095	0.054	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
13	Q12955	1.01e-32	140	4377	0.095	0.022	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
14	A0A5F9ZI08	2.71e-32	139	1797	0.106	0.060	A0A5F9ZI08_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZH03	2.86e-32	139	1785	0.106	0.060	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHN0	2.86e-32	139	1777	0.106	0.060	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZHL3	3.15e-32	139	1858	0.101	0.055	A0A5F9ZHL3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHQ3	3.22e-32	138	1838	0.105	0.058	A0A5F9ZHQ3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHE2	3.30e-32	138	1806	0.101	0.056	A0A5F9ZHE2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZI36	3.34e-32	138	1846	0.102	0.056	A0A5F9ZI36_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.8e-37	136.4	Ankyrin repeat
2	PF12796 Ank_2	1.1e-44	162.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.3e-27	101.1	Ankyrin repeat
4	PF13637 Ank_4	1.3e-41	151.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	6.8e-43	155.5	Ankyrin repeats (many copies)
6	PF06701 MIB_HERC2	1.2e-42	155.1	Mib_herc2
7	PF14447 Prok-RING_4	0.087	24.0	Prokaryotic RING finger family 4
8	PF18346 SH3_15	1.2e-39	145.9	Mind bomb SH3 repeat domain
9	PF13923 zf-C3HC4_2	4.7e-05	34.4	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	2.3e-24	96.3	Zinc finger, C3HC4 type (RING finger)
11	PF00569 ZZ	9.3e-08	43.1	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261537

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355718	0.994	Delta-like protein 1
2	9606.ENSP00000254958	0.993	Protein jagged-1
3	9606.ENSP00000249749	0.984	Delta-like protein 4
4	9606.ENSP00000328169	0.959	Protein jagged-2
5	9606.ENSP00000277541	0.941	Neurogenic locus notch homolog protein 1
6	9606.ENSP00000263388	0.939	Neurogenic locus notch homolog protein 3
7	9606.ENSP00000256646	0.930	Neurogenic locus notch homolog protein 2
8	9606.ENSP00000385751	0.930	Serine/threonine-protein kinase MARK2
9	9606.ENSP00000272317	0.925	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000304697	0.924	Polyubiquitin-B
11	9606.ENSP00000358795	0.924	E3 ubiquitin-protein ligase NEURL1
12	9606.ENSP00000441543	0.924	Polyubiquitin-C
13	9606.ENSP00000388107	0.920	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000358815	0.913	E3 ubiquitin-protein ligase NEURL1B
15	9606.ENSP00000378704	0.831	Bromodomain-containing protein 2
16	9606.ENSP00000316357	0.807	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
17	9606.ENSP00000327077	0.774	Pericentriolar material 1 protein
18	9606.ENSP00000263713	0.739	Band 4.1-like protein 5
19	9606.ENSP00000386135	0.715	Death-associated protein kinase 1
20	9606.ENSP00000316176	0.668	Ubiquitin-conjugating enzyme E2 N

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.999	ubiquitin-protein transferase activity
GO:0042802	0.955	identical protein binding
GO:0061659	0.339	ubiquitin-like protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0008152	0.963	metabolic process
GO:0048518	0.963	positive regulation of biological process
GO:0048856	0.961	anatomical structure development
GO:0032501	0.959	multicellular organismal process
GO:0071704	0.948	organic substance metabolic process
GO:0044238	0.939	primary metabolic process
GO:0043170	0.936	macromolecule metabolic process
GO:0006807	0.935	nitrogen compound metabolic process
GO:0030100	0.932	regulation of endocytosis
GO:1901564	0.928	organonitrogen compound metabolic process
GO:0007275	0.924	multicellular organism development
GO:0030154	0.917	cell differentiation
GO:0050896	0.911	response to stimulus
GO:0048522	0.896	positive regulation of cellular process
GO:0019222	0.895	regulation of metabolic process
GO:0019538	0.892	protein metabolic process
GO:0009653	0.879	anatomical structure morphogenesis
GO:0048513	0.856	animal organ development
GO:0080090	0.855	regulation of primary metabolic process
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0044237	0.854	cellular metabolic process
GO:0051171	0.851	regulation of nitrogen compound metabolic process
GO:0009893	0.847	positive regulation of metabolic process
GO:0048731	0.843	system development
GO:0010604	0.842	positive regulation of macromolecule metabolic process
GO:0051173	0.817	positive regulation of nitrogen compound metabolic process
GO:0051716	0.815	cellular response to stimulus
GO:0051247	0.810	positive regulation of protein metabolic process
GO:0009056	0.807	catabolic process
GO:0007165	0.789	signal transduction
GO:0048259	0.786	regulation of receptor-mediated endocytosis
GO:0031401	0.769	positive regulation of protein modification process
GO:0006508	0.768	proteolysis
GO:0044248	0.720	cellular catabolic process
GO:0044260	0.703	cellular macromolecule metabolic process
GO:0044265	0.690	cellular macromolecule catabolic process
GO:0007399	0.687	nervous system development
GO:0048519	0.672	negative regulation of biological process
GO:0060429	0.651	epithelium development
GO:0043632	0.646	modification-dependent macromolecule catabolic process
GO:0009790	0.642	embryo development
GO:0007166	0.640	cell surface receptor signaling pathway
GO:1901565	0.636	organonitrogen compound catabolic process
GO:0048646	0.629	anatomical structure formation involved in morphogenesis
GO:0061053	0.623	somite development
GO:0036211	0.618	protein modification process
GO:0060972	0.617	left/right pattern formation
GO:0048523	0.615	negative regulation of cellular process
GO:0030163	0.589	protein catabolic process
GO:0050793	0.546	regulation of developmental process
GO:0001944	0.544	vasculature development
GO:0035282	0.512	segmentation
GO:0051865	0.496	protein autoubiquitination
GO:0007368	0.490	determination of left/right symmetry
GO:0016331	0.446	morphogenesis of embryonic epithelium
GO:0001568	0.438	blood vessel development
GO:0045595	0.432	regulation of cell differentiation
GO:0031398	0.424	positive regulation of protein ubiquitination
GO:0048568	0.417	embryonic organ development
GO:0009887	0.390	animal organ morphogenesis
GO:0002090	0.378	regulation of receptor internalization
GO:0048562	0.367	embryonic organ morphogenesis
GO:0035239	0.366	tube morphogenesis
GO:0043009	0.356	chordate embryonic development
GO:0009952	0.354	anterior/posterior pattern specification
GO:0030182	0.344	neuron differentiation
GO:0048583	0.333	regulation of response to stimulus
GO:0001756	0.322	somitogenesis
GO:0007219	0.301	Notch signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0032991	0.968	protein-containing complex
GO:0031410	0.953	cytoplasmic vesicle
GO:0016020	0.888	membrane
GO:0005856	0.395	cytoskeleton
GO:0015630	0.377	microtubule cytoskeleton
GO:1990234	0.372	transferase complex
GO:0140535	0.329	intracellular protein-containing complex
GO:0071944	0.314	cell periphery
GO:0030054	0.306	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]