StarFunc result for job id Q86YV0

User Input

>input (1011 residues)
MDPPSPSRTSQTQPTATSPLTSYRWHTGGGGEKAAGGFRWGRFAGWGRALSHQEPMVSTQ
PAPRSIFRRVLSAPPKESRTSRLRLSKALWGRHKNPPPEPDPEPEQEAPELEPEPELEPP
TPQIPEAPTPNVPVWDIGGFTLLDGKLVLLGGEEEGPRRPRVGSASSEGSIHVAMGNFRD
PDRMPGKTEPETAGPNQVHNVRGLLKRLKEKKKARLEPRDGPPSALGSRESLATLSELDL
GAERDVRIWPLHPSLLGEPHCFQVTWTGGSRCFSCRSAAERDRWIEDLRRQFQPTQDNVE
REETWLSVWVHEAKGLPRAAAGAPGVRAELWLDGALLARTAPRAGPGQLFWAERFHFEAL
PPARRLSLRLRGLGPGSAVLGRVALALEELDAPRAPAAGLERWFPLLGAPAGAALRARIR
ARRLRVLPSERYKELAEFLTFHYARLCGALEPALPAQAKEELAAAMVRVLRATGRAQALV
TDLGTAELARCGGREALLFRENTLATKAIDEYMKLVAQDYLQETLGQVVRRLCASTEDCE
VDPSKCPASELPEHQARLRNSCEEVFETIIHSYDWFPAELGIVFSSWREACKERGSEVLG
PRLVCASLFLRLLCPAILAPSLFGLAPDHPAPGPARTLTLIAKVIQNLANRAPFGEKEAY
MGFMNSFLEEHGPAMQCFLDQVAMVDVDAAPSGYQGSGDLALQLAVLHAQLCTIFAELDQ
TTRDTLEPLPTILRAIEEGQPVLVSVPMRLPLPPAQVHSSLSAGEKPGFLAPRDLPKHTP
LISKSQSLRSVRRSESWARPRPDEERPLRRPRPVQRTQSVPVRRPARRRQSAGPWPRPKG
SLSMGPAPRARPWTRDSASLPRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVAA
LREEQKVLSRLVESLSTQIRALTEQQEQLRGQLQDLDSRLRAGSSEFDSEHNLTSNEGHS
LKNLEHRLNEMERTQAQLRDAVQSLQLSPRTRGSWSQPQPLKAPCLNGDTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YV0	1.000	1.000	0.000	1011	1.000	1.000	Q86YV0.pdb.gz	RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens OX=9606 GN=RASAL3 PE=1 SV=2
2	PDB:7pgrN	0.252	0.113	3.194E-11	2423	0.085	0.035	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
3	PDB:7r03B	0.240	0.113	8.457E-11	2246	0.081	0.037	7r03B.pdb.gz
4	PDB:7r04B	0.248	0.116	1.776E-10	2229	0.074	0.034	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
5	PDB:7r04A	0.264	0.118	2.457E-10	2326	0.080	0.035	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
6	PDB:7mp5A	0.241	0.153	3.399E-10	1629	0.074	0.046	7mp5A.pdb.gz
7	PDB:1cjyA	0.107	0.166	3.459E-6	633	0.041	0.065	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
8	AFDB:X2JC00	0.133	0.102	8.321E-5	1404	0.056	0.041	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
9	PDB:5ixcA	0.106	0.153	2.047E-4	684	0.024	0.035	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	PDB:6pyuA	0.098	0.106	3.918E-4	930	0.067	0.073	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
11	PDB:5izrC	0.105	0.158	4.103E-4	659	0.025	0.038	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:7mezA	0.101	0.103	4.716E-4	989	0.051	0.053	7mezA.pdb.gz
13	AFDB:Q86SQ0	0.060	0.049	1.018E-3	1253	0.158	0.128	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
14	AFDB:Q6XK20	0.090	0.083	5.158E-3	1102	0.076	0.070	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1
15	AFDB:Q9R0Q1	0.074	0.110	1.722E-2	673	0.055	0.083	Q9R0Q1.pdb.gz	SYTL4_MOUSE Synaptotagmin-like protein 4 OS=Mus musculus OX=10090 GN=Sytl4 PE=1 SV=1
16	AFDB:A0A0K3AU72	0.087	0.061	2.383E-2	1698	0.136	0.081	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
17	AFDB:Q9Y4B5	0.079	0.044	2.496E-2	1905	0.166	0.088	Q9Y4B5.pdb.gz	MTCL1_HUMAN Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5
18	AFDB:O70173	0.101	0.072	2.868E-2	1505	0.130	0.087	O70173.pdb.gz	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
19	AFDB:P47135	0.063	0.060	4.157E-2	1091	0.113	0.104	P47135.pdb.gz	JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JSN1 PE=1 SV=1
20	AFDB:Q6FRV6	0.060	0.037	4.354E-2	2238	0.110	0.050	Q6FRV6.pdb.gz	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YV0	0.0	2020	1011	1.000	1.000	RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens OX=9606 GN=RASAL3 PE=1 SV=2
2	Q3UHC7	2.65e-148	474	1189	0.244	0.208	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
3	Q5VWQ8	7.60e-148	473	1189	0.244	0.208	DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2
4	Q9UJF2	1.70e-144	462	1139	0.262	0.233	NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2
5	D3YUS5	4.09e-144	464	1261	0.227	0.182	D3YUS5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
6	Q0VAV5	3.98e-142	459	1268	0.227	0.181	Q0VAV5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=1
7	E9PW37	1.07e-141	458	1286	0.227	0.179	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
8	Q9QUH6	1.40e-129	426	1308	0.230	0.178	SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus OX=10116 GN=Syngap1 PE=1 SV=2
9	Q96PV0	2.30e-129	426	1343	0.230	0.173	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
10	F6SEU4	2.50e-129	426	1340	0.230	0.174	SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus OX=10090 GN=Syngap1 PE=1 SV=2
11	Q6P730	2.88e-124	405	996	0.213	0.216	DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus OX=10116 GN=Dab2ip PE=1 SV=1
12	E7F1U4	1.40e-121	407	1507	0.261	0.175	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
13	Q8T498	4.46e-87	309	1580	0.198	0.127	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
14	Q8MLZ5	7.93e-83	294	1207	0.179	0.150	GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2
15	F1R3X3	3.16e-46	182	1010	0.139	0.140	F1R3X3_DANRE RAS p21 protein activator (GTPase-activating protein) 1a OS=Danio rerio OX=7955 GN=rasa1a PE=1 SV=2
16	Q3V090	5.36e-45	176	742	0.135	0.183	Q3V090_MOUSE Ras GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
17	Q91YX7	8.87e-45	177	813	0.135	0.167	Q91YX7_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
18	P20936	1.44e-44	177	1047	0.135	0.130	RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1 PE=1 SV=1
19	P50904	2.28e-44	177	1038	0.135	0.131	RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rasa1 PE=1 SV=1
20	E9PYG6	3.92e-44	176	1038	0.135	0.131	E9PYG6_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	0.31	22.7	Autophagy protein 16 (ATG16)
2	PF04108 ATG17_like	6.5e+02	11.1	Autophagy protein ATG17-like domain
3	PF04513 Baculo_PEP_C	7	18.2	Baculovirus polyhedron envelope protein, PEP, C terminus
4	PF16746 BAR_3	3.6e+02	12.1	BAR domain of APPL family
5	PF00168 C2	8.5	18.1	C2 domain
6	PF10482 CtIP_N	37	15.7	Tumour-suppressor protein CtIP N-terminal domain
7	PF01519 DUF16	4.9e+02	12.6	Protein of unknown function DUF16
8	PF13600 DUF4140	91	15.0	N-terminal domain of unknown function (DUF4140)
9	PF14362 DUF4407	4.3e+02	11.6	Domain of unknown function (DUF4407)
10	PF15960 DUF4763	2.7e+02	12.3	Domain of unknown function (DUF4763)
11	PF04912 Dynamitin	48	14.7	Dynamitin
12	PF06160 EzrA	5.5e+02	10.1	Septation ring formation regulator, EzrA
13	PF05377 FlaC_arch	2.6e+02	13.4	Flagella accessory protein C (FlaC)
14	PF15294 Leu_zip	4.9e+02	11.6	Leucine zipper
15	PF00169 PH	4.1e+02	12.9	PH domain
16	PF15406 PH_6	3.8e+02	12.8	Pleckstrin homology domain
17	PF00616 RasGAP	1.5e-17	75.6	GTPase-activator protein for Ras-like GTPase
18	PF12329 TMF_DNA_bd	89	14.5	TATA element modulatory factor 1 DNA binding
19	PF07926 TPR_MLP1_2	2.5e+02	13.1	TPR/MLP1/MLP2-like protein
20	PF06005 ZapB	6.8e+02	12.2	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341905

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246672	0.922	Nuclear receptor subfamily 1 group D member 1
2	9606.ENSP00000359052	0.778	Protein FAM102B
3	9606.ENSP00000470539	0.740	Protein PET100 homolog, mitochondrial
4	9606.ENSP00000482410	0.726	Jerky protein homolog
5	9606.ENSP00000470262	0.721	Trafficking protein particle complex subunit 5
6	9606.ENSP00000329920	0.719	Mast cell expressed membrane protein 1
7	9606.ENSP00000349359	0.714	SAM and SH3 domain-containing protein 3
8	9606.ENSP00000246792	0.706	Ras-related protein R-Ras
9	9606.ENSP00000263381	0.702	Protein Wiz
10	9606.ENSP00000170168	0.683	RNA exonuclease 1 homolog
11	9606.ENSP00000264400	0.682	Ras-GEF domain-containing family member 1B
12	9606.ENSP00000351137	0.680	Pre-mRNA-splicing factor SYF1
13	9606.ENSP00000310585	0.679	Purkinje cell protein 2 homolog
14	9606.ENSP00000363944	0.678	Ribosomal biogenesis protein LAS1L
15	9606.ENSP00000407586	0.668	GTPase HRas
16	9606.ENSP00000358548	0.643	GTPase NRas
17	9606.ENSP00000351015	0.638	Neurofibromin
18	9606.ENSP00000289104	0.635	Ras-related protein M-Ras
19	9606.ENSP00000256078	0.632	GTPase KRas
20	9606.ENSP00000256196	0.632	Ras-related protein R-Ras2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0008047	0.304	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009966	0.991	regulation of signal transduction
GO:0002682	0.977	regulation of immune system process
GO:0048585	0.956	negative regulation of response to stimulus
GO:0002684	0.952	positive regulation of immune system process
GO:0051056	0.936	regulation of small GTPase mediated signal transduction
GO:0042127	0.924	regulation of cell population proliferation
GO:0048522	0.920	positive regulation of cellular process
GO:0050865	0.907	regulation of cell activation
GO:0048523	0.891	negative regulation of cellular process
GO:0051249	0.846	regulation of lymphocyte activation
GO:0009968	0.837	negative regulation of signal transduction
GO:0050867	0.836	positive regulation of cell activation
GO:0050670	0.835	regulation of lymphocyte proliferation
GO:0050896	0.828	response to stimulus
GO:0051251	0.826	positive regulation of lymphocyte activation
GO:0050863	0.819	regulation of T cell activation
GO:1903037	0.816	regulation of leukocyte cell-cell adhesion
GO:0070665	0.813	positive regulation of leukocyte proliferation
GO:0042129	0.807	regulation of T cell proliferation
GO:1903039	0.793	positive regulation of leukocyte cell-cell adhesion
GO:0009987	0.788	cellular process
GO:0050870	0.770	positive regulation of T cell activation
GO:0032946	0.765	positive regulation of mononuclear cell proliferation
GO:0046634	0.709	regulation of alpha-beta T cell activation
GO:0050671	0.687	positive regulation of lymphocyte proliferation
GO:0046578	0.651	regulation of Ras protein signal transduction
GO:0046580	0.591	negative regulation of Ras protein signal transduction
GO:0042102	0.528	positive regulation of T cell proliferation
GO:0046640	0.492	regulation of alpha-beta T cell proliferation
GO:0051716	0.402	cellular response to stimulus
GO:0046635	0.338	positive regulation of alpha-beta T cell activation
GO:0007154	0.314	cell communication
GO:0023052	0.312	signaling
GO:0007165	0.300	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005576	0.998	extracellular region
GO:0031982	0.998	vesicle
GO:1903561	0.992	extracellular vesicle
GO:0005615	0.983	extracellular space
GO:0070062	0.949	extracellular exosome
GO:0005886	0.948	plasma membrane
GO:0098562	0.936	cytoplasmic side of membrane
GO:0043229	0.935	intracellular organelle
GO:0043231	0.881	intracellular membrane-bounded organelle
GO:0012505	0.388	endomembrane system
GO:0032991	0.325	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]