StarFunc result for job id Q86YV5

User Input

>input (1406 residues)
MHQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRL
PPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTEANLSAEVSQVIWRRAPGKL
PLPKQEDAPVVYLGSFRGVQKPAGPSTSPDGNSRCPPAYTMVGLHNLEPRGERNIAFHPV
SFPEEKAVHKEKPSFPYQDRPSTQESFRQKLAAFAGTTSGCHQGPGPLRESLPSEDDSDQ
RCSPSGDSEGGEYCSILDCCPGSPVAKAASQTAGSRGRHGGRDCSPTCWEQGKCSGPAEQ
EKRGPSFPKECCSQGPTAHPSCLGPKKLSLTSEAAISSDGLSCGSGSGSGSGASSPFVPH
LESDYCSLMKEPAPEKQQDPGCPGVTPSRCLGLTGEPQPPAHPREATQPEPIYAESTKRK
KAAPVPSKSQAKIEHAAAAQGQGQVCTGNAWAQKAASGWGRDSPDPTPQVSATITVMAAH
PEEDHRTIYLSSPDSAVGVQWPRGPVSQNSEVGEEETSAGQGLSSRESHAHSASESKPKE
RPAIPPKLSKSSPVGSPVSPSAGGPPVSPLADLSDGSSGGSSIGPQPPSQGPADPAPSCR
TNGVAISDPSRCPQPAASSASEQRRPRFQAGTWSRQCRIEEEEEVEQELLSHSWGRETKN
GPTDHSNSTTWHRLHPTDGSSGQNSKVGTGMSKSASFAFEFPKDRSGIETFSPPPPPPKS
RHLLKMNKSSSDLEKVSQGSAESLSPSFRGVHVSFTTGSTDSLASDSRTCSDGGPSSELA
HSPTNSGKKLFAPVPFPSGSTEDVSPSGPQQPPPLPQKKIVSRAASSPDGFFWTQGSPKP
GTASPKLNLSHSETNVHDESHFSYSLSPGNRHHPVFSSSDPLEKAFKGSGHWLPAAGLAG
NRGGCGSPGLQCKGAPSASSSQLSVSSQASTGSTQLQLHGLLSNISSKEGTYAKLGGLYT
QSLARLVAKCEDLFMGGQKKELHFNENNWSLFKLTCNKPCCDSGDAIYYCATCSEDPGST
YAVKICKAPEPKTVSYCSPSVPVHFNIQQDCGHFVASVPSSMLSSPDAPKDPVPALPTHP
PAQEQDCVVVITREVPHQTASDFVRDSAASHQAEPEAYERRVCFLLLQLCNGLEHLKEHG
IIHRDLCLENLLLVHCTLQAGPGPAPAPAPAPAPAAAAPPCSSAAPPAGGTLSPAAGPAS
PEGPREKQLPRLIISNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQTGIL
IYELLHQPNPFEVRAQLRERDYRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKRIRIGE
AKRVLQCLLWGPRRELVQQPGTSEEALCGTLHNWIDMKRALMMMKFAEKAVDRRRGVELE
DWLCCQYLASAEPGALLQSLKLLQLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q571I4	0.417	0.425	0.000	1373	0.757	0.776	Q571I4.pdb.gz	PRAG1_MOUSE Inactive tyrosine-protein kinase PRAG1 OS=Mus musculus OX=10090 GN=Prag1 PE=1 SV=3
2	AFDB:Q86YV5	1.000	1.000	0.000	1406	1.000	1.000	Q86YV5.pdb.gz	PRAG1_HUMAN Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4
3	AFDB:Q69Z38	0.274	0.224	7.029E-46	1735	0.319	0.259	Q69Z38.pdb.gz	PEAK1_MOUSE Inactive tyrosine-protein kinase PEAK1 OS=Mus musculus OX=10090 GN=Peak1 PE=1 SV=4
4	AFDB:X1WGC5	0.276	0.227	1.225E-45	1725	0.304	0.248	X1WGC5.pdb.gz	X1WGC5_DANRE Pseudopodium-enriched atypical kinase 1 OS=Danio rerio OX=7955 GN=peak1 PE=4 SV=1
5	AFDB:Q9H792	0.283	0.231	1.280E-43	1746	0.304	0.245	Q9H792.pdb.gz	PEAK1_HUMAN Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4
6	AFDB:P0CY24	0.131	0.148	3.556E-8	1228	0.144	0.165	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
7	AFDB:P18161	0.143	0.172	5.445E-7	1155	0.128	0.156	P18161.pdb.gz	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2
8	PDB:4eomC	0.128	0.543	5.640E-7	276	0.043	0.221	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
9	PDB:2yaaA	0.128	0.516	5.211E-6	300	0.045	0.210	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
10	PDB:6s73A	0.142	0.641	6.064E-6	269	0.043	0.227	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
11	PDB:5u6yA	0.129	0.361	6.378E-6	459	0.041	0.126	5u6yA.pdb.gz
12	PDB:4krcA	0.128	0.528	1.230E-5	297	0.038	0.178	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:8dksA	0.128	0.541	1.843E-5	283	0.037	0.184	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
14	AFDB:A1Z6I7	0.140	0.135	1.872E-5	1460	0.139	0.134	A1Z6I7.pdb.gz	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
15	PDB:6khdB	0.129	0.486	2.039E-5	332	0.038	0.160	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
16	PDB:4rgjA	0.139	0.379	2.496E-5	463	0.044	0.134	4rgjA.pdb.gz
17	PDB:5x3fB	0.146	0.486	2.496E-5	349	0.047	0.189	5x3fB.pdb.gz
18	PDB:7qwkH	0.132	0.608	2.625E-5	259	0.038	0.208	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
19	AFDB:Q14004	0.144	0.134	3.103E-5	1512	0.124	0.115	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
20	AFDB:Q8INJ8	0.143	0.188	1.277E-4	1052	0.121	0.162	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZMK9	0.0	1947	1368	0.745	0.765	PRAG1_RAT Inactive tyrosine-protein kinase PRAG1 OS=Rattus norvegicus OX=10116 GN=Prag1 PE=1 SV=1
2	Q571I4	0.0	1924	1373	0.749	0.767	PRAG1_MOUSE Inactive tyrosine-protein kinase PRAG1 OS=Mus musculus OX=10090 GN=Prag1 PE=1 SV=3
3	Q86YV5	0.0	2847	1406	1.000	1.000	PRAG1_HUMAN Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4
4	Q69Z38	1.46e-123	425	1735	0.174	0.141	PEAK1_MOUSE Inactive tyrosine-protein kinase PEAK1 OS=Mus musculus OX=10090 GN=Peak1 PE=1 SV=4
5	Q9H792	8.17e-115	400	1746	0.185	0.149	PEAK1_HUMAN Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4
6	X1WGC5	3.58e-111	389	1725	0.159	0.129	X1WGC5_DANRE Pseudopodium-enriched atypical kinase 1 OS=Danio rerio OX=7955 GN=peak1 PE=4 SV=1
7	Q0KHV6	9.48e-10	65.9	721	0.044	0.086	PINK1_DROME Serine/threonine-protein kinase Pink1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pink1 PE=1 SV=1
8	D6WMX4	5.31e-07	56.6	570	0.039	0.096	PINK1_TRICA Serine/threonine-protein kinase Pink1, mitochondrial OS=Tribolium castaneum OX=7070 GN=Pink1 PE=1 SV=1
9	Q6ZS72	1.16e-06	55.5	473	0.023	0.068	PEAK3_HUMAN Protein PEAK3 OS=Homo sapiens OX=9606 GN=PEAK3 PE=1 SV=1
10	Q5PRB2	1.26e-06	55.5	574	0.034	0.084	Q5PRB2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wu:fc39e12 PE=2 SV=1
11	A2QIL5	1.49e-06	55.5	1007	0.039	0.055	ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=atg1 PE=3 SV=1
12	Q52EB3	1.87e-06	55.1	982	0.037	0.053	ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=ATG1 PE=1 SV=1
13	Q4WPF2	2.57e-06	54.7	973	0.041	0.060	ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=atg1 PE=3 SV=1
14	O48963	1.68e-04	48.9	996	0.041	0.057	PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana OX=3702 GN=PHOT1 PE=1 SV=1
15	E0W1I1	3.79e-04	47.4	575	0.023	0.057	PINK1_PEDHC Serine/threonine-protein kinase Pink1, mitochondrial OS=Pediculus humanus subsp. corporis OX=121224 GN=Pink1 PE=1 SV=1
16	Q9SV69	4.59e-04	46.6	372	0.036	0.137	Q9SV69_ARATH AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g13000 PE=2 SV=1
17	Q9BXM7	4.93e-04	47.0	581	0.042	0.102	PINK1_HUMAN Serine/threonine-protein kinase PINK1, mitochondrial OS=Homo sapiens OX=9606 GN=PINK1 PE=1 SV=1
18	Q49HN0	0.001	45.4	559	0.036	0.091	Q49HN0_DANRE G protein-coupled receptor kinase OS=Danio rerio OX=7955 GN=GRK1B PE=1 SV=1
19	Q8H935	0.001	46.2	963	0.038	0.056	Q8H935_VICFA Phototropin OS=Vicia faba OX=3906 GN=Vfphot1a PE=1 SV=1
20	B5DFG1	0.002	45.1	580	0.028	0.069	PINK1_RAT Serine/threonine-protein kinase PINK1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pink1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	3.5e-08	44.7	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	0.0081	27.0	Protein tyrosine and serine/threonine kinase
3	PF04360 Serglycin	20	16.6	Serglycin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220003	0.942	Tyrosine-protein kinase CSK
2	9606.ENSP00000466680	0.773	Rho-related GTP-binding protein RhoN
3	9606.ENSP00000381298	0.706	LON peptidase N-terminal domain and ring finger 1
4	9606.ENSP00000468308	0.698	Pseudokinase FAM20A
5	9606.ENSP00000352925	0.654	Transformation/transcription domain-associated protein
6	9606.ENSP00000469880	0.619	Inactive serine/threonine-protein kinase VRK3
7	9606.ENSP00000297029	0.601	Adseverin
8	9606.ENSP00000370288	0.588	Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr and Tyr residues of target proteins (AMPylation) . May be a redox-active mitochondrial selenoprotein which interacts with a redox target protein .
9	9606.ENSP00000354387	0.529	Nicotinamide riboside kinase 1
10	9606.ENSP00000376345	0.519	Growth factor receptor-bound protein 2
11	9606.ENSP00000276616	0.518	Protein serine kinase H2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003824	0.600	catalytic activity
GO:0016740	0.446	transferase activity
GO:0016772	0.422	transferase activity, transferring phosphorus-containing groups
GO:0140096	0.376	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050789	0.960	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0048870	0.544	cell motility
GO:0008152	0.454	metabolic process
GO:0048518	0.435	positive regulation of biological process
GO:0071704	0.418	organic substance metabolic process
GO:0048583	0.365	regulation of response to stimulus
GO:0048522	0.351	positive regulation of cellular process
GO:0044238	0.321	primary metabolic process
GO:1901564	0.314	organonitrogen compound metabolic process
GO:0016477	0.308	cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.991	cytosol
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005634	0.979	nucleus
GO:0030054	0.957	cell junction
GO:0070161	0.930	anchoring junction
GO:0005925	0.911	focal adhesion
GO:0031974	0.485	membrane-enclosed lumen
GO:0070013	0.484	intracellular organelle lumen
GO:0031981	0.384	nuclear lumen
GO:0005654	0.343	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.446	Transferases.
EC:2.7.-.-	0.422	Transferring phosphorus-containing groups.

[back to server]