StarFunc result for job id Q86YV6

User Input

>input (388 residues)
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSN
ADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQV
HKCEETATGLKLAAKIIKTRGMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVM
EYVDGGELFDRIIDESYNLTELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDA
KQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGL
SPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPW
LSDHKLHSRLNAQKKKNRGSDAQDFVTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YV6	1.000	1.000	3.454E-72	388	1.000	1.000	Q86YV6.pdb.gz	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
2	PDB:2x4fA	0.727	0.971	5.938E-47	289	0.737	0.990	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
3	AFDB:Q32MK0	0.746	0.356	2.011E-46	819	0.554	0.263	Q32MK0.pdb.gz	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
4	AFDB:A8C984	0.744	0.406	2.416E-45	715	0.552	0.299	A8C984.pdb.gz	MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio OX=7955 GN=mylk3 PE=2 SV=1
5	AFDB:Q3UIZ8	0.733	0.361	1.134E-44	795	0.546	0.267	Q3UIZ8.pdb.gz	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
6	AFDB:P07313	0.741	0.476	3.355E-42	608	0.487	0.311	P07313.pdb.gz	MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=MYLK2 PE=1 SV=3
7	AFDB:Q9H1R3	0.741	0.485	1.335E-41	596	0.479	0.312	Q9H1R3.pdb.gz	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
8	AFDB:Q8VCR8	0.739	0.471	1.965E-41	613	0.492	0.312	Q8VCR8.pdb.gz	MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus OX=10090 GN=Mylk2 PE=1 SV=2
9	AFDB:A8C985	0.673	0.296	5.679E-34	899	0.405	0.175	A8C985.pdb.gz
10	AFDB:O01653	0.672	0.321	3.147E-33	832	0.361	0.168	O01653.pdb.gz	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
11	AFDB:A1Z7Y7	0.683	0.303	1.651E-32	888	0.348	0.152	A1Z7Y7.pdb.gz	A1Z7Y7_DROME Spaghetti-squash activator, isoform C OS=Drosophila melanogaster OX=7227 GN=sqa PE=4 SV=2
12	PDB:2yaaA	0.668	0.857	3.751E-29	300	0.332	0.430	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
13	PDB:5u6yA	0.623	0.530	3.729E-23	459	0.258	0.218	5u6yA.pdb.gz
14	PDB:3soaA	0.615	0.550	2.349E-21	436	0.245	0.218	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
15	PDB:8bfsA	0.591	0.818	4.313E-21	274	0.268	0.380	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
16	PDB:4rerA	0.612	0.521	5.784E-20	459	0.211	0.179	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:4rgjA	0.576	0.486	1.186E-19	463	0.273	0.229	4rgjA.pdb.gz
18	PDB:4zhxA	0.605	0.575	1.563E-19	409	0.198	0.188	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:6b1uA	0.605	0.534	2.570E-19	442	0.198	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:6tcaA	0.528	0.588	4.226E-19	345	0.242	0.272	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YV6	0.0	808	388	1.000	1.000	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
2	A8C984	1.61e-159	467	715	0.539	0.292	MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio OX=7955 GN=mylk3 PE=2 SV=1
3	Q32MK0	3.52e-157	464	819	0.544	0.258	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
4	E9PT87	8.25e-154	454	786	0.559	0.276	MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus OX=10116 GN=Mylk3 PE=1 SV=1
5	Q3UIZ8	4.52e-153	453	795	0.534	0.260	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
6	Q8VCR8	2.99e-127	381	613	0.459	0.290	MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus OX=10090 GN=Mylk2 PE=1 SV=2
7	P07313	1.07e-126	379	608	0.454	0.289	MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=MYLK2 PE=1 SV=3
8	P20689	1.23e-125	377	610	0.451	0.287	MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus OX=10116 GN=Mylk2 PE=1 SV=2
9	Q9H1R3	9.67e-125	374	596	0.448	0.292	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
10	G1U9Q7	1.24e-92	306	1903	0.371	0.076	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
11	Q15746	4.05e-92	305	1914	0.374	0.076	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
12	Q6PDN3	5.59e-92	304	1941	0.371	0.074	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
13	Q95SK9	8.08e-92	285	446	0.332	0.289	Q95SK9_DROME GH17420p OS=Drosophila melanogaster OX=7227 GN=sqa PE=1 SV=1
14	L0MN91	1.79e-90	300	8866	0.358	0.016	L0MN91_DROME Bent, isoform I OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
15	D1YSG0	1.84e-90	300	8933	0.358	0.016	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
16	Q9GV81	1.93e-90	285	577	0.338	0.227	Q9GV81_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
17	X2JD89	2.05e-90	300	8602	0.358	0.016	X2JD89_DROME Bent, isoform J OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
18	Q7KQP6	2.07e-90	300	8648	0.358	0.016	Q7KQP6_DROME Bent, isoform C OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
19	Q961U1	2.07e-90	300	1721	0.358	0.081	Q961U1_DROME GH07636p OS=Drosophila melanogaster OX=7227 GN=bt PE=2 SV=1
20	L0MPZ1	2.21e-90	300	8408	0.358	0.017	L0MPZ1_DROME Bent, isoform H OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.3e-05	35.2	ABC1 atypical kinase-like domain
2	PF01636 APH	45	15.3	Phosphotransferase enzyme family
3	PF19546 DUF6070	3e+02	11.8	Family of unknown function (DUF6070)
4	PF06293 Kdo	0.086	23.8	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	74	14.1	Kinase-like
6	PF00069 Pkinase	1.4e-69	246.0	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	7.1e-35	132.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217652	0.851	Myosin regulatory light chain 12A
2	9606.ENSP00000279022	0.845	Myosin regulatory light polypeptide 9
3	9606.ENSP00000463559	0.826	Myosin regulatory light chain 12B
4	9606.ENSP00000306124	0.804	Protein kinase C epsilon type
5	9606.ENSP00000379210	0.724	Myosin light chain 3
6	9606.ENSP00000228841	0.708	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
7	9606.ENSP00000223364	0.697	Myosin regulatory light chain 2, atrial isoform
8	9606.ENSP00000325239	0.691	Myosin light chain, phosphorylatable, fast skeletal muscle
9	9606.ENSP00000347055	0.689	Myosin light chain 4
10	9606.ENSP00000309591	0.685	cAMP-dependent protein kinase catalytic subunit alpha
11	9606.ENSP00000366488	0.683	cAMP-dependent protein kinase catalytic subunit gamma
12	9606.ENSP00000359719	0.682	cAMP-dependent protein kinase catalytic subunit beta
13	9606.ENSP00000312457	0.669	Brain and acute leukemia, cytoplasmic
14	9606.ENSP00000272298	0.663	Calmodulin 2 (phosphorylase kinase, delta)
15	9606.ENSP00000223167	0.658	Myosin regulatory light chain 10
16	9606.ENSP00000304643	0.658	Calmodulin-like protein 6
17	9606.ENSP00000315299	0.658	Calmodulin-like protein 3
18	9606.ENSP00000369689	0.658	Calmodulin-like protein 5
19	9606.ENSP00000419081	0.658	Calmodulin-like protein 4
20	9606.ENSP00000446955	0.657	Myosin light polypeptide 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004672	0.999	protein kinase activity
GO:0004674	0.994	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.970	biological regulation
GO:0050789	0.963	regulation of biological process
GO:0050794	0.870	regulation of cellular process
GO:0008152	0.703	metabolic process
GO:0044237	0.660	cellular metabolic process
GO:0044238	0.628	primary metabolic process
GO:0071704	0.627	organic substance metabolic process
GO:0006807	0.612	nitrogen compound metabolic process
GO:0043170	0.581	macromolecule metabolic process
GO:0019538	0.529	protein metabolic process
GO:0016310	0.409	phosphorylation
GO:0036211	0.403	protein modification process
GO:0050896	0.397	response to stimulus
GO:0006468	0.381	protein phosphorylation
GO:0048518	0.363	positive regulation of biological process
GO:0032501	0.308	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.983	nucleus
GO:0043232	0.788	intracellular non-membrane-bounded organelle
GO:0099512	0.615	supramolecular fiber
GO:0043292	0.444	contractile fiber
GO:0005829	0.418	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]