StarFunc result for job id Q86YW0

User Input

>input (608 residues)
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGM
PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVEGQGLIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASL
FVYVWYVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YW0	1.000	1.000	0.000	608	1.000	1.000	Q86YW0.pdb.gz	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
2	AFDB:Q8K4D7	0.959	0.902	5.428E-104	647	0.745	0.700	Q8K4D7.pdb.gz	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
3	AFDB:Q5FX52	0.965	0.910	1.045E-103	645	0.745	0.702	Q5FX52.pdb.gz	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
4	AFDB:F1Q5G9	0.878	0.708	9.927E-80	761	0.419	0.335	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
5	AFDB:C9JEA7	0.848	0.654	4.738E-79	794	0.446	0.341	C9JEA7.pdb.gz	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
6	AFDB:Q9BRC7	0.848	0.682	6.177E-78	762	0.444	0.354	Q9BRC7.pdb.gz	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
7	AFDB:Q62711	0.840	0.666	1.007E-76	772	0.416	0.328	Q62711.pdb.gz	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
8	AFDB:Q8K3R3	0.825	0.627	3.032E-75	807	0.429	0.323	Q8K3R3.pdb.gz	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
9	AFDB:H2LIC9	0.815	0.753	8.281E-75	659	0.446	0.411	H2LIC9.pdb.gz	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2
10	AFDB:F1QJ13	0.855	0.682	1.427E-73	769	0.421	0.333	F1QJ13.pdb.gz	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
11	PDB:4gnkB	0.776	0.622	4.889E-53	769	0.342	0.270	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.176	0.170	1.054E-7	633	0.038	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.173	0.155	7.034E-7	684	0.041	0.037	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5izrC	0.168	0.156	8.794E-7	659	0.041	0.038	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5a50A	0.168	0.568	2.402E-6	165	0.039	0.145	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:4rj9A	0.132	0.469	3.003E-6	161	0.036	0.137	4rj9A.pdb.gz
17	PDB:5iz5A	0.169	0.138	3.175E-6	757	0.041	0.033	5iz5A.pdb.gz
18	PDB:5iz5B	0.179	0.147	3.970E-6	746	0.039	0.032	5iz5B.pdb.gz
19	PDB:5a52A	0.170	0.605	5.867E-6	154	0.043	0.169	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:3pfqA	0.141	0.162	8.673E-6	523	0.043	0.050	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FX52	0.0	943	645	0.743	0.701	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
2	Q86YW0	0.0	1269	608	1.000	1.000	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
3	Q8K4D7	0.0	956	647	0.755	0.709	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
4	C9JEA7	5.47e-169	503	794	0.442	0.339	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
5	Q9BRC7	6.47e-168	499	762	0.429	0.343	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
6	H2LIC9	3.60e-165	488	659	0.441	0.407	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2
7	F1Q5G9	2.61e-163	487	761	0.429	0.343	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
8	Q62711	2.63e-159	477	772	0.421	0.332	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
9	P10688	3.67e-152	458	756	0.419	0.337	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
10	Q8R3B1	8.96e-152	457	756	0.419	0.337	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
11	F1QJ13	1.53e-151	457	769	0.423	0.334	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
12	P51178	3.37e-148	448	756	0.418	0.336	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
13	Q8N3E9	1.03e-146	445	789	0.400	0.308	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
14	Q8K394	2.31e-146	454	1128	0.395	0.213	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
15	Q8K2J0	2.77e-146	444	785	0.396	0.307	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
16	A0A8I6AGE0	8.05e-146	441	744	0.400	0.327	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
17	Q9UPR0	1.57e-145	451	1127	0.393	0.212	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
18	Q15111	4.67e-142	441	1095	0.395	0.219	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
19	Q3USB7	3.46e-137	429	1096	0.385	0.214	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
20	Q62688	1.43e-134	422	1096	0.380	0.211	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	9.9e-10	50.0	C2 domain
2	PF14788 EF-hand_10	1.1e+02	14.1	EF hand
3	PF13405 EF-hand_6	97	14.2	EF-hand domain
4	PF13499 EF-hand_7	83	15.1	EF-hand domain pair
5	PF09279 EF-hand_like	2.7e-19	80.8	Phosphoinositide-specific phospholipase C, efhand-like
6	PF00388 PI-PLC-X	8e-56	199.1	Phosphatidylinositol-specific phospholipase C, X domain
7	PF00387 PI-PLC-Y	4.8e-35	131.7	Phosphatidylinositol-specific phospholipase C, Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266505

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306253	0.954	Inositol 1,4,5-trisphosphate receptor type 1
2	9606.ENSP00000373399	0.944	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
3	9606.ENSP00000363435	0.938	Inositol 1,4,5-trisphosphate receptor type 3
4	9606.ENSP00000265382	0.928	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
5	9606.ENSP00000357883	0.927	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
6	9606.ENSP00000466363	0.926	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
7	9606.ENSP00000370744	0.923	Inositol 1,4,5-trisphosphate receptor type 2
8	9606.ENSP00000347032	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
9	9606.ENSP00000365757	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
10	9606.ENSP00000482548	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
11	9606.ENSP00000332983	0.848	Postacrosomal sheath WW domain-binding protein
12	9606.ENSP00000326238	0.842	F-actin-capping protein subunit alpha-3
13	9606.ENSP00000408695	0.836	Protein kinase C alpha type
14	9606.ENSP00000360777	0.829	72 kDa inositol polyphosphate 5-phosphatase
15	9606.ENSP00000263431	0.815	Protein kinase C gamma type
16	9606.ENSP00000305355	0.815	Protein kinase C beta type
17	9606.ENSP00000362115	0.796	Type II inositol 1,4,5-trisphosphate 5-phosphatase
18	9606.ENSP00000347792	0.783	Synaptojanin-2
19	9606.ENSP00000483154	0.776	Protein FAM71D
20	9606.ENSP00000360154	0.774	Inositol polyphosphate 5-phosphatase OCRL-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004435	0.999	phosphatidylinositol phospholipase C activity
GO:0005515	0.998	protein binding
GO:0043168	0.997	anion binding
GO:0008289	0.996	lipid binding
GO:0005546	0.993	phosphatidylinositol-4,5-bisphosphate binding
GO:0032266	0.992	phosphatidylinositol-3-phosphate binding
GO:0010314	0.992	phosphatidylinositol-5-phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.992	cellular process
GO:0065008	0.979	regulation of biological quality
GO:0009566	0.977	fertilization
GO:0001775	0.951	cell activation
GO:0007338	0.951	single fertilization
GO:0007343	0.729	egg activation
GO:0050794	0.707	regulation of cellular process
GO:0007204	0.597	positive regulation of cytosolic calcium ion concentration
GO:0007154	0.454	cell communication
GO:0023052	0.433	signaling
GO:0050896	0.412	response to stimulus
GO:0051716	0.336	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005634	0.959	nucleus
GO:0016020	0.871	membrane
GO:0070013	0.814	intracellular organelle lumen
GO:0031981	0.769	nuclear lumen
GO:0005654	0.720	nucleoplasm
GO:0061827	0.592	sperm head
GO:0071944	0.400	cell periphery
GO:0005886	0.315	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.999	phosphoinositide phospholipase C.

[back to server]