StarFunc result for job id Q86YW7

User Input

>input (130 residues)
MKLAFLFLGPMALLLLAGYGCVLGASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDAC
WGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGAC
STATTECETI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YW7	1.000	1.000	2.240E-21	130	1.000	1.000	Q86YW7.pdb.gz	GPHB5_HUMAN Glycoprotein hormone beta-5 OS=Homo sapiens OX=9606 GN=GPHB5 PE=1 SV=1
2	AFDB:Q812B2	0.853	0.853	8.319E-18	130	0.869	0.869	Q812B2.pdb.gz	GPHB5_MOUSE Glycoprotein hormone beta-5 OS=Mus musculus OX=10090 GN=Gphb5 PE=2 SV=1
3	AFDB:P01231	0.682	0.632	1.475E-7	141	0.354	0.326	P01231.pdb.gz	LSHB_SHEEP Lutropin subunit beta OS=Ovis aries OX=9940 GN=LHB PE=1 SV=3
4	AFDB:C0HA57	0.679	0.626	2.137E-7	142	0.338	0.310	C0HA57.pdb.gz	C0HA57_SALSA Gonadotropin subunit beta-2 OS=Salmo salar OX=8030 GN=GTHB2 PE=2 SV=1
5	AFDB:Q9DG80	0.672	0.627	2.938E-7	140	0.323	0.300	Q9DG80.pdb.gz	GTHB2_ICTPU Gonadotropin subunit beta-2 OS=Ictalurus punctatus OX=7998 GN=cgbb PE=2 SV=1
6	AFDB:Q5UK78	0.671	0.625	3.830E-7	140	0.338	0.314	Q5UK78.pdb.gz
7	AFDB:O09108	0.693	0.642	4.259E-7	141	0.285	0.262	O09108.pdb.gz	LSHB_MOUSE Lutropin subunit beta OS=Mus musculus OX=10090 GN=Lhb PE=2 SV=2
8	AFDB:A5JSW4	0.672	0.599	4.491E-7	147	0.346	0.306	A5JSW4.pdb.gz	A5JSW4_HYPNO LH-beta subunit OS=Hypophthalmichthys nobilis OX=7965 PE=2 SV=1
9	AFDB:Q9DG81	0.684	0.674	1.368E-6	132	0.269	0.265	Q9DG81.pdb.gz	GTHB1_ICTPU Gonadotropin subunit beta-1 OS=Ictalurus punctatus OX=7998 GN=cgba PE=2 SV=1
10	AFDB:P01229	0.655	0.607	1.603E-6	141	0.285	0.262	P01229.pdb.gz	LSHB_HUMAN Lutropin subunit beta OS=Homo sapiens OX=9606 GN=LHB PE=1 SV=3
11	PDB:7t9iB	0.635	0.748	5.838E-6	109	0.246	0.294	7t9iB.pdb.gz
12	PDB:4mqwB	0.628	0.738	2.318E-5	109	0.262	0.312	4mqwB.pdb.gz
13	PDB:1hcnB	0.683	0.799	6.694E-5	110	0.223	0.264	1hcnB.pdb.gz
14	PDB:4my2A	0.496	0.159	1.793E-3	474	0.131	0.036	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
15	PDB:5hk5F	0.471	0.474	1.345E-2	129	0.162	0.163	5hk5F.pdb.gz
16	PDB:2k8pA	0.390	0.288	1.418E-2	189	0.162	0.111	2k8pA.pdb.gz
17	PDB:5nxsA	0.315	0.162	1.387E-1	290	0.131	0.059	5nxsA.pdb.gz
18	PDB:5ntuA	0.322	0.160	2.764E-1	308	0.115	0.049	5ntuA.pdb.gz
19	PDB:6q2sA	0.336	0.415	5.506E-1	98	0.123	0.163	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
20	PDB:1m4uA	0.326	0.228	6.123E-1	199	0.115	0.075	1m4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YW7	7.18e-94	268	130	1.000	1.000	GPHB5_HUMAN Glycoprotein hormone beta-5 OS=Homo sapiens OX=9606 GN=GPHB5 PE=1 SV=1
2	Q812B2	4.98e-74	218	130	0.869	0.869	GPHB5_MOUSE Glycoprotein hormone beta-5 OS=Mus musculus OX=10090 GN=Gphb5 PE=2 SV=1
3	A5JSW4	2.47e-17	74.7	147	0.292	0.259	A5JSW4_HYPNO LH-beta subunit OS=Hypophthalmichthys nobilis OX=7965 PE=2 SV=1
4	Q6TCF5	2.77e-17	74.7	140	0.292	0.271	Q6TCF5_DANRE Lhb protein OS=Danio rerio OX=7955 GN=lhbeta1 PE=2 SV=1
5	W5UK74	4.31e-17	73.9	140	0.315	0.293	W5UK74_ICTPU Gonadotropin subunit beta-2 OS=Ictalurus punctatus OX=7998 GN=cgbb PE=2 SV=1
6	Q9DG80	6.34e-17	73.6	140	0.315	0.293	GTHB2_ICTPU Gonadotropin subunit beta-2 OS=Ictalurus punctatus OX=7998 GN=cgbb PE=2 SV=1
7	P04651	1.33e-16	72.8	141	0.323	0.298	LSHB_BOVIN Lutropin subunit beta OS=Bos taurus OX=9913 GN=LHB PE=1 SV=1
8	Q800P3	1.95e-16	72.4	137	0.331	0.314	Q800P3_ONCKI Luteinizing hormone beta (Fragment) OS=Oncorhynchus kisutch OX=8019 PE=2 SV=1
9	C0HA57	1.97e-16	72.4	142	0.285	0.261	C0HA57_SALSA Gonadotropin subunit beta-2 OS=Salmo salar OX=8030 GN=GTHB2 PE=2 SV=1
10	P01231	2.51e-16	72.0	141	0.323	0.298	LSHB_SHEEP Lutropin subunit beta OS=Ovis aries OX=9940 GN=LHB PE=1 SV=3
11	Q9DG92	3.15e-16	72.0	142	0.292	0.268	Q9DG92_ONCMY Luteinizing hormone beta subunit OS=Oncorhynchus mykiss OX=8022 GN=LH beta PE=2 SV=1
12	Q9PS36	1.92e-15	68.9	107	0.300	0.364	FSHB_LITCT Follitropin subunit beta OS=Lithobates catesbeianus OX=8400 GN=fshb PE=1 SV=1
13	Q9W6Q7	1.92e-14	65.9	88	0.246	0.364	Q9W6Q7_SALSA Gonadotropin II beta subunit (Fragment) OS=Salmo salar OX=8030 PE=2 SV=1
14	P07732	4.08e-14	66.2	142	0.262	0.239	GTHB2_ONCTS Gonadotropin subunit beta-2 OS=Oncorhynchus tshawytscha OX=74940 GN=cgbb PE=2 SV=1
15	Q4V4C8	2.99e-12	62.0	169	0.262	0.201	Q4V4C8_DROME Glycoprotein hormone beta 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Gpb5 PE=2 SV=1
16	O09108	1.13e-11	60.1	141	0.292	0.270	LSHB_MOUSE Lutropin subunit beta OS=Mus musculus OX=10090 GN=Lhb PE=2 SV=2
17	Q60687	1.48e-11	59.3	130	0.269	0.269	FSHB_MOUSE Follitropin subunit beta OS=Mus musculus OX=10090 GN=Fshb PE=2 SV=1
18	P18427	1.99e-11	59.3	130	0.262	0.262	FSHB_RAT Follitropin subunit beta OS=Rattus norvegicus OX=10116 GN=Fshb PE=2 SV=2
19	Q6EV79	8.10e-11	57.4	129	0.269	0.271	FSHB_MACFA Follitropin subunit beta OS=Macaca fascicularis OX=9541 GN=FSHB PE=2 SV=1
20	Q8QGF8	8.53e-11	57.4	131	0.254	0.252	Q8QGF8_CHICK FSH beta OS=Gallus gallus OX=9031 GN=FSHb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	5e-15	67.0	Cystine-knot domain
2	PF03045 DAN	64	15.0	DAN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478993

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279168	0.993	Glycoprotein hormone alpha-2
2	9606.ENSP00000384708	0.831	Follicle-stimulating hormone receptor
3	9606.ENSP00000441235	0.793	Thyrotropin receptor
4	9606.ENSP00000294954	0.707	Lutropin-choriogonadotropic hormone receptor
5	9606.ENSP00000384092	0.650	Pro-opiomelanocortin
6	9606.ENSP00000226413	0.623	Gonadotropin-releasing hormone receptor
7	9606.ENSP00000381105	0.598	Neuropeptide S
8	9606.ENSP00000256592	0.582	Thyrotropin subunit beta
9	9606.ENSP00000234371	0.555	KiSS-1 receptor
10	9606.ENSP00000369647	0.549	Vasopressin-neurophysin 2-copeptin
11	9606.ENSP00000282091	0.544	Parathyroid hormone
12	9606.ENSP00000331746	0.539	Calcitonin
13	9606.ENSP00000416606	0.533	Follitropin subunit beta
14	9606.ENSP00000362716	0.532	Somatoliberin
15	9606.ENSP00000221421	0.520	Lutropin subunit beta
16	9606.ENSP00000276571	0.520	Corticoliberin
17	9606.ENSP00000441765	0.517	Parathyroid hormone-related protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0001664	1.000	G protein-coupled receptor binding
GO:0051428	0.999	peptide hormone receptor binding
GO:0005179	0.999	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0007154	0.992	cell communication
GO:0023052	0.991	signaling
GO:0050896	0.988	response to stimulus
GO:0051716	0.955	cellular response to stimulus
GO:0007186	0.952	G protein-coupled receptor signaling pathway
GO:0007189	0.931	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0048583	0.368	regulation of response to stimulus
GO:0023051	0.307	regulation of signaling
GO:0010646	0.307	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.560	intracellular anatomical structure
GO:0005737	0.543	cytoplasm
GO:0005615	0.301	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]