StarFunc result for job id Q86YW9

User Input

>input (2145 residues)
MAAFGLLSYEQRPLKRPRLGPPDVYPQDPKQKEDELTAVNVKQGFNNQPAFTGDEHGSAR
NIVINPSKIGAYFSSILAEKLKLNTFQDTGKKKPQVNAKDNYWLVTARSQSAIHSWFSDL
AGNKPLSILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKKRQA
PDPNLEWTQISTRYLREQLAKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHM
FQEGMLEKHEYLTWILDVLEKIRPMDDDLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCAR
RLSLLLSDSPNLLAAHSPHMMIGPNNSSIGAPSPGPPGPGMSPVQLAFSDFLSCAQHGPL
VYGLSCMLQTVTLCCPSALVWNYSTNENKSANPGSPLDLLQVAPSSLPMPGGNTAFNQQV
RARIYEVEQQIKQRGRAVEVRWSFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSM
ETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIE
AERCGESEVLDEKESISSSSLAGSSLPVFQNVLLRFLDTQAPSLSDPNSECEKVEFVNLV
LLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTRPRSPVGENADEHYSKDHDVKMEIFSP
MPGESCENANTSLGRRMSVNCEKLVKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSS
HECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKSTTETGVGDEGQKARKNKQETF
PTLETVFTKLQLLSYFDQHQVTSQISNNVLEQITSFASGTSYHLPLAHHIQLIFDLMEPA
LNINGLIDFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQ
TAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQT
IYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLGKILSDNAANRYSFVCNTLMNVCM
GHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSNHVWGFNDVLCTVDVSDLSF
HDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADAEPGARMTCRLLLHLFRAPQ
ACFLPQATGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGNNSVSSLK
NDDFTMRGLRCDGNADDIWTASQNPKSCGKSISIETANLREYARYVLRTICQQEWVGEHC
LKEPERLCTDKELILDPVLSNMQAQKLLQLICYPHGIKECTEGDNLQRQHIKRILQNLEQ
WTLRQSWLELQLMIKQCLKDPGSGSVAEMNNLLDNIAKATIEVFQQSADLNNSSNSGMSL
FNPNSIGSADTSSTRQNGIKTFLSSSERRGVWLVAPLIARLPTSVQGRVLKAAGEELEKG
QHLGSSSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNW
REERYQDDIKARQMMHEALQLRLNLVGGMFDTVQRSTQWTTDWALLLLQIITSGTVDMHT
NNELFTTVLDMLGVLINGTLASDLSNASPGGSEENKRAYMNLVKKLKKELGDKRSESIDK
VRQLLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQ
KNPAPLSWAWFGTVRVDRRVIKYEEQHHLLLYHTHPMPKPRSYYLQPLPLPPEEEEEEPT
SPVSQEPERKSAELSDQGKTTTDEEKKTKGRKRKTKSSSRVDEYPQSNIYRVPPNYSPIS
SQMMHHPQSTLWGYNLVGQPQQPGFFLQNQSLTPGGSRLDPAGSFVPTNTKQALSNMLQR
RSGAMMQPPSLHAITSQQQLIQMKLLQQQQQQRLLRQAQTRPFQQGQPGDQAALFAAQAR
PSPQLPQYPGLQQAQTMPQGYTMYGTQMPLQQTSQQQAGSVVLSPSYNSRAYPAAHSNPV
LMERLRQIQQQPSGYVQQQASPYLQPLTGSQRLNHQALQQSPLVGGGIDAVLTSAHPNLP
SVPLPQDPMRPRQPQVRQQQRLLQMQQPQQPQPQQPPQPQQSSQSQSQTLGLQAMQPQQP
LFPRQGLQQTQQQQQTAALVRQLQKQLSSNQPQQGVTPYGHPSHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A096MKF8	0.684	0.670	0.000	2190	0.601	0.589	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
2	AFDB:Q2QCI8	0.706	0.697	0.000	2173	0.620	0.612	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
3	AFDB:Q86YW9	0.999	0.999	0.000	2145	1.000	1.000	Q86YW9.pdb.gz	MD12L_HUMAN Mediator of RNA polymerase II transcription subunit 12-like protein OS=Homo sapiens OX=9606 GN=MED12L PE=1 SV=2
4	AFDB:F4J8G7	0.099	0.099	1.402E-10	2138	0.129	0.129	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
5	AFDB:P29539	0.084	0.091	5.055E-9	1916	0.089	0.099	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
6	AFDB:Q5UIP0	0.097	0.090	8.522E-8	2472	0.091	0.079	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	AFDB:E1C2U2	0.097	0.092	1.365E-7	2326	0.091	0.084	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
8	PDB:6h02A	0.146	0.194	3.379E-7	1334	0.083	0.134	6h02A.pdb.gz
9	PDB:7kpxC	0.221	0.306	3.379E-7	1352	0.082	0.130	7kpxC.pdb.gz
10	AFDB:Q6TRW4	0.080	0.098	8.653E-7	1447	0.091	0.135	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
11	AFDB:Q9XZ34	0.106	0.142	1.199E-6	1416	0.074	0.112	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
12	AFDB:F4IAT2	0.100	0.115	2.064E-6	1823	0.096	0.113	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
13	PDB:7mqaLM	0.079	0.081	5.907E-6	2041	0.090	0.094	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mopA	0.087	0.080	1.219E-5	2445	0.085	0.074	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
15	PDB:7jq9A	0.095	0.088	1.264E-5	2427	0.078	0.069	7jq9A.pdb.gz
16	PDB:7kpvC	0.102	0.370	4.027E-5	487	0.024	0.105	7kpvC.pdb.gz
17	PDB:6zhaA	0.078	0.059	7.728E-5	3707	0.083	0.048	6zhaA.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
18	PDB:7sglA	0.077	0.054	7.728E-5	3852	0.094	0.052	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
19	PDB:7r5jB0	0.103	0.117	8.933E-5	1748	0.073	0.090	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7ajuUT	0.094	0.091	1.151E-4	2313	0.087	0.081	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKF8	0.0	2296	2190	0.581	0.569	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
2	A0A0G2K4W3	0.0	2272	2169	0.578	0.572	A0A0G2K4W3_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=2
3	A0A8I6A1Z4	0.0	2276	2020	0.579	0.614	A0A8I6A1Z4_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
4	A2AGH6	0.0	2296	2190	0.575	0.563	MED12_MOUSE Mediator of RNA polymerase II transcription subunit 12 OS=Mus musculus OX=10090 GN=Med12 PE=1 SV=1
5	D3ZDE6	0.0	2288	2156	0.579	0.576	D3ZDE6_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=3
6	Q2QCI8	0.0	2402	2173	0.599	0.591	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
7	Q86YW9	0.0	4459	2145	1.000	1.000	MD12L_HUMAN Mediator of RNA polymerase II transcription subunit 12-like protein OS=Homo sapiens OX=9606 GN=MED12L PE=1 SV=2
8	Q93074	0.0	2303	2177	0.586	0.577	MED12_HUMAN Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12 PE=1 SV=4
9	Q9VW47	0.0	753	2531	0.219	0.185	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
10	Q20497	6.47e-37	156	3498	0.138	0.085	MED12_CAEEL Mediator of RNA polymerase II transcription subunit 12 OS=Caenorhabditis elegans OX=6239 GN=dpy-22 PE=1 SV=2
11	H3K2Y6	6.84e-05	50.8	2235	0.037	0.035	MED12_ARATH Mediator of RNA polymerase II transcription subunit 12 OS=Arabidopsis thaliana OX=3702 GN=MED12 PE=1 SV=1
12	Q9QYX7	0.16	39.7	5068	0.043	0.018	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
13	Q9JKS6	0.17	39.7	5085	0.042	0.018	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
14	Q9W2L2	0.67	37.7	1202	0.015	0.027	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
15	Q70ZY9	2.4	35.8	737	0.013	0.037	Q70ZY9_DANRE HIC1 protein OS=Danio rerio OX=7955 GN=zfHIC1 PE=2 SV=1
16	P32521	7.8	34.3	1480	0.010	0.015	PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09497 Med12	7.6e-11	53.5	Transcription mediator complex subunit Med12
2	PF12145 Med12-LCEWAV	7.2e-183	620.4	Eukaryotic Mediator 12 subunit domain
3	PF12144 Med12-PQL	9.2e-64	226.7	Eukaryotic Mediator 12 catenin-binding domain
4	PF02789 Peptidase_M17_N	6e+02	11.8	Cytosol aminopeptidase family, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417235

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380888	0.997	Mediator of RNA polymerase II transcription subunit 13
2	9606.ENSP00000281928	0.995	Mediator of RNA polymerase II transcription subunit 13-like
3	9606.ENSP00000428982	0.987	Cyclin-C
4	9606.ENSP00000357907	0.983	Cyclin dependent kinase 19
5	9606.ENSP00000370938	0.972	Cyclin-dependent kinase 8
6	9606.ENSP00000286317	0.966	Mediator of RNA polymerase II transcription subunit 7
7	9606.ENSP00000300651	0.955	Mediator of RNA polymerase II transcription subunit 1
8	9606.ENSP00000337340	0.953	Mediator of RNA polymerase II transcription subunit 19
9	9606.ENSP00000323720	0.929	Mediator of RNA polymerase II transcription subunit 14
10	9606.ENSP00000362948	0.917	Mediator of RNA polymerase II transcription subunit 18
11	9606.ENSP00000292035	0.901	Mediator of RNA polymerase II transcription subunit 27
12	9606.ENSP00000282892	0.863	Mediator of RNA polymerase II transcription subunit 21
13	9606.ENSP00000251871	0.861	Mediator of RNA polymerase II transcription subunit 17
14	9606.ENSP00000297347	0.861	Mediator of RNA polymerase II transcription subunit 30
15	9606.ENSP00000258648	0.838	Mediator of RNA polymerase II transcription subunit 4
16	9606.ENSP00000325612	0.820	Mediator of RNA polymerase II transcription subunit 16
17	9606.ENSP00000377686	0.819	Mediator of RNA polymerase II transcription subunit 24
18	9606.ENSP00000363193	0.810	Mediator of RNA polymerase II transcription subunit 12
19	9606.ENSP00000357047	0.805	Mediator of RNA polymerase II transcription subunit 23
20	9606.ENSP00000352925	0.789	Transformation/transcription domain-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.950	transcription regulator activity
GO:0003824	0.869	catalytic activity
GO:0140096	0.777	catalytic activity, acting on a protein
GO:0016740	0.643	transferase activity
GO:0003712	0.594	transcription coregulator activity
GO:0061659	0.508	ubiquitin-like protein ligase activity
GO:0061630	0.496	ubiquitin protein ligase activity
GO:0003713	0.309	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0044238	0.985	primary metabolic process
GO:0043412	0.978	macromolecule modification
GO:0050789	0.964	regulation of biological process
GO:0050794	0.944	regulation of cellular process
GO:0009893	0.944	positive regulation of metabolic process
GO:0070647	0.931	protein modification by small protein conjugation or removal
GO:0019219	0.925	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.919	regulation of RNA metabolic process
GO:0031325	0.916	positive regulation of cellular metabolic process
GO:0009987	0.890	cellular process
GO:0032446	0.857	protein modification by small protein conjugation
GO:0006357	0.847	regulation of transcription by RNA polymerase II
GO:0010604	0.822	positive regulation of macromolecule metabolic process
GO:0051173	0.814	positive regulation of nitrogen compound metabolic process
GO:0045935	0.766	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.708	positive regulation of cellular biosynthetic process
GO:0051254	0.695	positive regulation of RNA metabolic process
GO:0045893	0.693	positive regulation of DNA-templated transcription
GO:0016567	0.627	protein ubiquitination
GO:0045944	0.598	positive regulation of transcription by RNA polymerase II
GO:0044237	0.481	cellular metabolic process
GO:2000142	0.374	regulation of DNA-templated transcription initiation
GO:1901360	0.352	organic cyclic compound metabolic process
GO:2000144	0.346	positive regulation of DNA-templated transcription initiation
GO:0060261	0.335	positive regulation of transcription initiation by RNA polymerase II
GO:0090304	0.329	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0110165	0.996	cellular anatomical entity
GO:0005654	0.992	nucleoplasm
GO:1902494	0.945	catalytic complex
GO:0140513	0.938	nuclear protein-containing complex
GO:0016020	0.925	membrane
GO:0140535	0.905	intracellular protein-containing complex
GO:1990234	0.902	transferase complex
GO:0016592	0.884	mediator complex
GO:0005667	0.852	transcription regulator complex
GO:0000151	0.812	ubiquitin ligase complex
GO:0090575	0.740	RNA polymerase II transcription regulator complex
GO:0005737	0.373	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.643	Transferases.

[back to server]