StarFunc result for job id Q86YZ3

User Input

>input (1400 residues)
MPKLLQGVITVIDVFYQYATQHGEYDTLNKAELKELLENEFHQILKNPNDPDTVDIILQS
LDRDHNKKVDFTEYLLMIFKLVQARNKIIGKDYCQVSGSKLRDDTHQHQEEQEETEKEEN
KRQESSFSHSSWSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYG
EQNSDSHQSSGRGQCGSGSGQSPNYGQHGSGSGQSSSNDTHGSGSGQSSGFSQHKSSSGQ
SSGYSQHGSGSGHSSGYGQHGSRSGQSSRGERHRSSSGSSSSYGQHGSGSRQSLGHGRQG
SGSRQSPSHVRHGSGSGHSSSHGQHGSGSSYSYSRGHYESGSGQTSGFGQHESGSGQSSG
YSKHGSGSGHSSSQGQHGSTSGQASSSGQHGSSSRQSSSYGQHESASRHSSGRGQHSSGS
GQSPGHGQRGSGSGQSPSSGQHGTGFGRSSSSGPYVSGSGYSSGFGHHESSSEHSSGYTQ
HGSGSGHSSGHGQHGSRSGQSSRGERQGSSAGSSSSYGQHGSGSRQSLGHSRHGSGSGQS
PSPSRGRHESGSRQSSSYGPHGYGSGRSSSRGPYESGSGHSSGLGHQESRSGQSSGYGQH
GSSSGHSSTHGQHGSTSGQSSSCGQHGATSGQSSSHGQHGSGSSQSSRYGQQGSGSGQSP
SRGRHGSDFGHSSSYGQHGSGSGWSSSNGPHGSVSGQSSGFGHKSGSGQSSGYSQHGSGS
SHSSGYRKHGSRSGQSSRSEQHGSSSGLSSSYGQHGSGSHQSSGHGRQGSGSGHSPSRVR
HGSSSGHSSSHGQHGSGTSCSSSCGHYESGSGQASGFGQHESGSGQGYSQHGSASGHFSS
QGRHGSTSGQSSSSGQHDSSSGQSSSYGQHESASHHASGRGRHGSGSGQSPGHGQRGSGS
GQSPSYGRHGSGSGRSSSSGRHGSGSGQSSGFGHKSSSGQSSGYTQHGSGSGHSSSYEQH
GSRSGQSSRSEQHGSSSGSSSSYGQHGSGSRQSLGHGQHGSGSGQSPSPSRGRHGSGSGQ
SSSYGPYRSGSGWSSSRGPYESGSGHSSGLGHRESRSGQSSGYGQHGSSSGHSSTHGQHG
STSGQSSSCGQHGASSGQSSSHGQHGSGSSQSSGYGRQGSGSGQSPGHGQRGSGSRQSPS
YGRHGSGSGRSSSSGQHGSGLGESSGFGHHESSSGQSSSYSQHGSGSGHSSGYGQHGSRS
GQSSRGERHGSSSGSSSHYGQHGSGSRQSSGHGRQGSGSGHSPSRGRHGSGLGHSSSHGQ
HGSGSGRSSSRGPYESRSGHSSVFGQHESGSGHSSAYSQHGSGSGHFCSQGQHGSTSGQS
STFDQEGSSTGQSSSYGHRGSGSSQSSGYGRHGAGSGQSPSRGRHGSGSGHSSSYGQHGS
GSGWSSSSGRHGSGSGQSSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5D862	0.081	0.053	2.950E-36	2391	0.500	0.293	Q5D862.pdb.gz	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
2	AFDB:Q8VHD8	0.079	0.046	1.464E-28	2496	0.511	0.287	Q8VHD8.pdb.gz	HORN_MOUSE Hornerin OS=Mus musculus OX=10090 GN=Hrnr PE=1 SV=1
3	AFDB:Q2VIS4	0.078	0.048	2.022E-23	2362	0.417	0.247	Q2VIS4.pdb.gz	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
4	AFDB:Q05331	0.072	0.082	1.374E-12	1218	0.256	0.295	Q05331.pdb.gz	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
5	AFDB:P97347	0.076	0.093	9.926E-11	1118	0.182	0.228	P97347.pdb.gz	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
6	PDB:5csnA	0.064	0.897	2.135E-6	94	0.020	0.298	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
7	PDB:5hloC	0.062	0.858	2.789E-6	93	0.016	0.237	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
8	PDB:2lucA	0.062	0.761	3.189E-6	105	0.019	0.257	2lucA.pdb.gz
9	PDB:7psqG	0.065	0.767	5.092E-6	108	0.017	0.222	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
10	PDB:1k96A	0.060	0.887	6.223E-6	89	0.017	0.270	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
11	PDB:2kayA	0.062	0.862	6.223E-6	92	0.018	0.272	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
12	PDB:6zdyA	0.059	0.721	1.063E-5	108	0.016	0.204	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
13	PDB:2k2fA	0.062	0.772	1.299E-5	93	0.021	0.312	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
14	PDB:7nmiB	0.065	0.183	1.814E-5	488	0.023	0.066	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
15	PDB:7ui5A	0.058	0.625	2.370E-5	114	0.022	0.272	7ui5A.pdb.gz	Evolution avoids a pathological stabilizing interaction in the immune protein S100A9.
16	AFDB:F4I1T7	0.032	0.027	4.786E-2	1819	0.176	0.136	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
17	AFDB:P21519	0.033	0.030	5.471E-2	1594	0.168	0.147	P21519.pdb.gz	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
18	AFDB:Q9VU86	0.035	0.027	1.221E-1	1873	0.114	0.085	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
19	AFDB:M9PHT1	0.048	0.036	2.912E-1	2007	0.174	0.122	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
20	AFDB:Q13428	0.045	0.044	2.912E-1	1488	0.160	0.151	Q13428.pdb.gz	TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YZ3	0.0	2341	2850	1.000	0.491	HORN_HUMAN Hornerin OS=Homo sapiens OX=9606 GN=HRNR PE=1 SV=2
2	Q2VIS4	1.33e-49	196	2362	0.066	0.039	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
3	Q5D862	6.45e-46	184	2391	0.066	0.039	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
4	O96124	9.69e-45	181	2441	0.164	0.094	O96124_PLAF7 Erythrocyte membrane protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201900 PE=4 SV=1
5	P20930	5.08e-35	149	4061	0.044	0.015	FILA_HUMAN Filaggrin OS=Homo sapiens OX=9606 GN=FLG PE=1 SV=3
6	Q05331	1.70e-31	137	1218	0.044	0.050	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
7	P97347	2.30e-28	126	1118	0.036	0.045	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
8	Q6XPR3	3.82e-27	122	784	0.031	0.056	RPTN_HUMAN Repetin OS=Homo sapiens OX=9606 GN=RPTN PE=1 SV=1
9	Q9UBG3	8.78e-24	109	495	0.028	0.079	CRNN_HUMAN Cornulin OS=Homo sapiens OX=9606 GN=CRNN PE=1 SV=1
10	Q8CIU0	7.05e-22	103	501	0.032	0.090	Q8CIU0_RAT Profilaggrin (Fragment) OS=Rattus norvegicus OX=10116 GN=Flg PE=4 SV=1
11	A0A0B4J1F9	2.21e-15	84.7	1599	0.027	0.024	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
12	Q8VHD8	2.68e-12	74.7	2496	0.086	0.048	HORN_MOUSE Hornerin OS=Mus musculus OX=10090 GN=Hrnr PE=1 SV=1
13	Q8IIK5	6.97e-10	66.2	1201	0.021	0.024	Q8IIK5_PLAF7 Rhoptry neck protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1116000 PE=4 SV=2
14	P80511	1.57e-08	55.5	92	0.022	0.337	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
15	P79105	4.13e-08	54.3	92	0.020	0.304	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
16	Q07283	2.41e-07	58.2	1943	0.028	0.020	TRHY_HUMAN Trichohyalin OS=Homo sapiens OX=9606 GN=TCHH PE=1 SV=2
17	P80310	2.82e-07	52.0	92	0.024	0.359	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
18	P50116	3.94e-06	49.3	113	0.020	0.248	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
19	P06702	8.60e-06	48.5	114	0.018	0.219	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
20	P02638	4.34e-05	45.8	92	0.020	0.304	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13499 EF-hand_7	11	17.9	EF-hand domain pair
2	PF01023 S_100	4.9e-13	59.8	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357791

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357736	0.665	Late cornified envelope like proline rich 1
2	9606.ENSP00000332163	0.630	Small proline-rich protein 4
3	9606.ENSP00000357731	0.625	Loricrin
4	9606.ENSP00000475216	0.616	Keratinocyte proline rich protein
5	9606.ENSP00000339251	0.580	Keratinocyte differentiation-associated protein
6	9606.ENSP00000357697	0.578	Protein S100-A2
7	9606.ENSP00000357789	0.558	Filaggrin
8	9606.ENSP00000333952	0.556	Late cornified envelope protein 5A
9	9606.ENSP00000357702	0.549	Protein S100-A3
10	9606.ENSP00000357753	0.540	Involucrin
11	9606.ENSP00000306461	0.527	Cornifin-B
12	9606.ENSP00000334644	0.517	Late cornified envelope protein 3C
13	9606.ENSP00000484472	0.517	Epiplakin
14	9606.ENSP00000357712	0.515	S100 calcium binding protein A7
15	9606.ENSP00000320430	0.504	S100 calcium binding protein Z
16	9606.ENSP00000357714	0.500	S100 calcium binding protein A7 like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046872	0.966	metal ion binding
GO:0005509	0.844	calcium ion binding
GO:0046914	0.501	transition metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048513	0.997	animal organ development
GO:0009888	0.997	tissue development
GO:0060429	0.994	epithelium development
GO:0008544	0.994	epidermis development
GO:0043588	0.993	skin development
GO:0098773	0.984	skin epidermis development
GO:0071840	0.889	cellular component organization or biogenesis
GO:0016043	0.884	cellular component organization
GO:0045229	0.848	external encapsulating structure organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0005737	0.996	cytoplasm
GO:0031982	0.996	vesicle
GO:0005886	0.996	plasma membrane
GO:0005634	0.996	nucleus
GO:0001533	0.993	cornified envelope
GO:0070013	0.993	intracellular organelle lumen
GO:0030141	0.985	secretory granule
GO:0043230	0.979	extracellular organelle
GO:0005615	0.963	extracellular space
GO:0070062	0.953	extracellular exosome
GO:0031012	0.949	extracellular matrix
GO:0062023	0.942	collagen-containing extracellular matrix
GO:0000323	0.875	lytic vacuole
GO:0005764	0.871	lysosome
GO:0005766	0.837	primary lysosome
GO:0048471	0.813	perinuclear region of cytoplasm
GO:0035578	0.782	azurophil granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]