StarFunc result for job id Q86Z02

User Input

>input (1210 residues)
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSH
QVANFNIPAYDQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQK
CGLKRKSEEVDSNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQH
EILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSR
LSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVA
TALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRA
PEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTD
MLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNME
ICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATL
SLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQ
TGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQGSCTPLMVATLHPQVATIT
PQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMI
PEAMGSGQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS
LPSKKNKQSAPVSSKSSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPS
PPVSVITIRSDTDEEEDNKYKPSSSGLKPRSNVISYVTVNDSPDSDSSLSSPYSTDTLSA
LRGNSGSVLEGPGRVVADGTGTRTIIVPPLKTQLGDCTVATQASGLLSNKTKPVASVSGQ
SSGCCITPTGYRAQRGGTSAAQPLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQA
PYTFQHGSPLHSTGHPHLAPAPAHLPSQAHLYTYAAPTSAAALGSTSSIAHLFSPQGSSR
HAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLS
PTKISQYSYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KP92	0.352	0.362	0.000	1176	0.969	0.997	J3KP92.pdb.gz	J3KP92_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
2	AFDB:O88904	0.503	0.503	0.000	1210	0.976	0.976	O88904.pdb.gz	HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2
3	AFDB:Q5SQL3	0.359	0.371	0.000	1165	0.962	0.999	Q5SQL3.pdb.gz	Q5SQL3_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
4	AFDB:S6BAK9	0.353	0.347	1.811E-101	1231	0.635	0.624	S6BAK9.pdb.gz
5	AFDB:Q9H2X6	0.376	0.379	3.897E-100	1198	0.644	0.650	Q9H2X6.pdb.gz	HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
6	AFDB:H7BXX9	0.333	0.435	1.040E-91	911	0.532	0.707	H7BXX9.pdb.gz	H7BXX9_HUMAN Homeodomain interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
7	AFDB:Q9ERH7	0.327	0.331	6.714E-83	1192	0.491	0.498	Q9ERH7.pdb.gz	HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus OX=10090 GN=Hipk3 PE=1 SV=3
8	AFDB:Q9H422	0.332	0.331	8.709E-83	1215	0.472	0.470	Q9H422.pdb.gz	HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens OX=9606 GN=HIPK3 PE=1 SV=1
9	AFDB:M9PDR2	0.331	0.319	2.622E-64	1256	0.374	0.360	M9PDR2.pdb.gz	M9PDR2_DROME Homeodomain interacting protein kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
10	AFDB:A1L1U2	0.263	0.422	8.431E-32	737	0.155	0.255	A1L1U2.pdb.gz	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
11	PDB:6khdB	0.238	0.831	6.672E-26	332	0.084	0.307	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
12	PDB:5y86A	0.245	0.724	1.888E-25	395	0.090	0.276	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
13	PDB:6kheA	0.242	0.820	6.246E-25	342	0.079	0.281	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
14	PDB:6qx9K	0.240	0.866	1.228E-24	322	0.084	0.317	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:6fadC	0.236	0.750	1.008E-21	359	0.081	0.273	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
16	PDB:4krcA	0.218	0.838	1.855E-20	297	0.071	0.290	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:1unlA	0.201	0.797	2.922E-19	292	0.069	0.288	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:1j1bB	0.196	0.625	1.130E-18	364	0.074	0.247	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
19	PDB:3mi9A	0.211	0.717	1.254E-18	329	0.073	0.267	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
20	PDB:4eomC	0.199	0.824	5.107E-18	276	0.075	0.330	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6M3Q6U2	0.0	692	1409	0.275	0.236	A0A6M3Q6U2_DROME Homeodomain interacting protein kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
2	F1Q4N0	0.0	1374	1228	0.647	0.638	F1Q4N0_DANRE Homeodomain-interacting protein kinase 2 OS=Danio rerio OX=7955 GN=cb1009 PE=4 SV=1
3	F6NWN5	0.0	854	1229	0.441	0.434	F6NWN5_DANRE Homeodomain-interacting protein kinase 3a OS=Danio rerio OX=7955 GN=si:dkey-21k24.2 PE=4 SV=1
4	H7BXX9	0.0	1204	911	0.504	0.670	H7BXX9_HUMAN Homeodomain interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
5	J3KP92	0.0	2401	1176	0.972	1.000	J3KP92_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
6	M9PDR2	0.0	691	1256	0.275	0.265	M9PDR2_DROME Homeodomain interacting protein kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
7	O88904	0.0	2432	1210	0.977	0.977	HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2
8	Q5SQL3	0.0	2238	1165	0.963	1.000	Q5SQL3_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
9	Q86Z02	0.0	2484	1210	1.000	1.000	HIPK1_HUMAN Homeodomain-interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
10	Q8MQ70	0.0	556	846	0.217	0.310	HIPK_CAEEL Homeodomain-interacting protein kinase 1 OS=Caenorhabditis elegans OX=6239 GN=hpk-1 PE=2 SV=1
11	Q9ERH7	0.0	954	1192	0.502	0.509	HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus OX=10090 GN=Hipk3 PE=1 SV=3
12	Q9H2X6	0.0	1451	1198	0.650	0.656	HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
13	Q9H422	0.0	957	1215	0.508	0.506	HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens OX=9606 GN=HIPK3 PE=1 SV=1
14	Q9QZR5	0.0	1466	1196	0.654	0.661	HIPK2_MOUSE Homeodomain-interacting protein kinase 2 OS=Mus musculus OX=10090 GN=Hipk2 PE=1 SV=2
15	Q9W0Q1	0.0	692	1340	0.275	0.249	Q9W0Q1_DROME Homeodomain interacting protein kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=2
16	Q95TG3	4.31e-156	497	1068	0.202	0.229	Q95TG3_DROME SD08329p OS=Drosophila melanogaster OX=7227 GN=Hipk PE=2 SV=1
17	Q8NE63	3.30e-107	352	616	0.145	0.286	HIPK4_HUMAN Homeodomain-interacting protein kinase 4 OS=Homo sapiens OX=9606 GN=HIPK4 PE=1 SV=1
18	Q3V016	1.60e-106	350	616	0.145	0.286	HIPK4_MOUSE Homeodomain-interacting protein kinase 4 OS=Mus musculus OX=10090 GN=Hipk4 PE=1 SV=2
19	Q9P6P3	1.11e-75	263	534	0.120	0.272	PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk15 PE=1 SV=1
20	D6RC95	2.91e-73	240	119	0.098	1.000	D6RC95_HUMAN Homeodomain interacting protein kinase 1 (Fragment) OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	77	14.6	Phosphotransferase enzyme family
2	PF17388 GP24_25	6.1e+02	12.3	Mycobacteriophage tail assembly protein
3	PF06293 Kdo	0.11	23.4	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	1e-46	171.0	Protein kinase domain
5	PF17667 Pkinase_fungal	80	13.4	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	5.9e-21	86.5	Protein tyrosine and serine/threonine kinase
7	PF05445 Pox_ser-thr_kin	1.1e+02	13.2	Poxvirus serine/threonine protein kinase
8	PF19974 TCAD9	61	14.1	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.934	Cellular tumor antigen p53
2	9606.ENSP00000365663	0.900	Natriuretic peptides A
3	9606.ENSP00000462099	0.890	Ras association domain-containing protein 5
4	9606.ENSP00000218068	0.742	Intrinsically disordered protein that potentiates the transcriptional activator activity of JUN (PubMed:24263171, PubMed:28289210). Protects cells from stress-induced apoptosis by inhibiting reactive oxygen species (ROS) production and via regulation of the MAPK signaling pathway (PubMed:21357425, PubMed:25374899, PubMed:30658679). ECO:0000269\|PubMed:24263171, ECO:0000269\|PubMed:25374899,
5	9606.ENSP00000483236	0.723	DDB1- and CUL4-associated factor 7
6	9606.ENSP00000363668	0.718	Death domain-associated protein 6
7	9606.ENSP00000327758	0.710	Homeobox protein Nkx-2.5
8	9606.ENSP00000436786	0.685	Histone-lysine N-methyltransferase 2A
9	9606.ENSP00000344456	0.677	Catenin beta-1
10	9606.ENSP00000362107	0.648	Four and a half LIM domains 3
11	9606.ENSP00000268058	0.647	Protein PML
12	9606.ENSP00000334458	0.637	Transcription factor GATA-4
13	9606.ENSP00000380516	0.616	Homeobox-containing protein 1
14	9606.ENSP00000258149	0.568	E3 ubiquitin-protein ligase Mdm2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.989	protein serine/threonine kinase activity
GO:0140110	0.344	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0050896	0.981	response to stimulus
GO:0071704	0.899	organic substance metabolic process
GO:0044237	0.892	cellular metabolic process
GO:0051716	0.883	cellular response to stimulus
GO:0044238	0.881	primary metabolic process
GO:0032502	0.859	developmental process
GO:0006807	0.821	nitrogen compound metabolic process
GO:0008219	0.814	cell death
GO:0019222	0.804	regulation of metabolic process
GO:0048856	0.800	anatomical structure development
GO:0043170	0.778	macromolecule metabolic process
GO:0023052	0.770	signaling
GO:0048518	0.770	positive regulation of biological process
GO:0031323	0.761	regulation of cellular metabolic process
GO:0007154	0.760	cell communication
GO:0019538	0.733	protein metabolic process
GO:0007165	0.726	signal transduction
GO:0080090	0.713	regulation of primary metabolic process
GO:0036211	0.700	protein modification process
GO:0060255	0.641	regulation of macromolecule metabolic process
GO:0048522	0.637	positive regulation of cellular process
GO:0048523	0.608	negative regulation of cellular process
GO:0032501	0.588	multicellular organismal process
GO:0006796	0.562	phosphate-containing compound metabolic process
GO:0051171	0.556	regulation of nitrogen compound metabolic process
GO:0006468	0.533	protein phosphorylation
GO:0006915	0.523	apoptotic process
GO:0071840	0.497	cellular component organization or biogenesis
GO:0010468	0.463	regulation of gene expression
GO:0048583	0.458	regulation of response to stimulus
GO:0035556	0.455	intracellular signal transduction
GO:0023051	0.447	regulation of signaling
GO:0010646	0.446	regulation of cell communication
GO:0016043	0.445	cellular component organization
GO:0009966	0.444	regulation of signal transduction
GO:0007275	0.441	multicellular organism development
GO:0006950	0.428	response to stress
GO:0009893	0.426	positive regulation of metabolic process
GO:0019219	0.395	regulation of nucleobase-containing compound metabolic process
GO:0033554	0.387	cellular response to stress
GO:0009653	0.355	anatomical structure morphogenesis
GO:0010604	0.341	positive regulation of macromolecule metabolic process
GO:0048513	0.337	animal organ development
GO:0051252	0.332	regulation of RNA metabolic process
GO:0031325	0.318	positive regulation of cellular metabolic process
GO:0009889	0.308	regulation of biosynthetic process
GO:0097190	0.305	apoptotic signaling pathway
GO:0009892	0.301	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005829	0.956	cytosol
GO:0032991	0.815	protein-containing complex
GO:0005856	0.785	cytoskeleton
GO:0015630	0.736	microtubule cytoskeleton
GO:0016604	0.644	nuclear body
GO:0005815	0.512	microtubule organizing center
GO:0005813	0.488	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]